(data stored in ACNUC9543 zone)

EMBL: AL844507.PE164

AL844507.PE164       Location/Qualifiers
FT   CDS             complement(join(767916..767949,768132..768258,
FT                   768365..768517,768675..768750,768845..769006,
FT                   769095..769490,769697..769792))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0816800"
FT                   /product="meiotic recombination protein DMC1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0816800"
FT                   /db_xref="GOA:Q8IB05"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR011940"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB05"
FT                   /protein_id="CAD51205.2"
FT                   /translation="MATLPASKSASKVALTSEVEDEGIKEHTFQEIEKLQDLGINAADI
FT                   NKLKGSGYCTILSLIQTTKKELCNVKGISEAKVDKILEVASKIENCSSFITANELVQKR
FT                   SKVLKITTGSTVFDQTLGGGIESMCITELFGENRCGKTQVCHTLAVTAQLPKSLNGGNG
FT                   KVCYIDTEGTFRPEKVCKIAERYGLDGEAVLDNILYARAFTHEHLYQLLAISAAKMCEE
FT                   PFALLVVDSIISLFRVDFSGRGELSERQQKLNKTMSILSKLSEQFNIAILITNQVMSDP
FT                   GATMTFIANPMKPVGGHVIGHASTIRLSLRKGKGDQRVCKVYDAPNLPEVECIFQLSDK
FT                   GVIDATD"
     MATLPASKSA SKVALTSEVE DEGIKEHTFQ EIEKLQDLGI NAADINKLKG SGYCTILSLI        60
     QTTKKELCNV KGISEAKVDK ILEVASKIEN CSSFITANEL VQKRSKVLKI TTGSTVFDQT       120
     LGGGIESMCI TELFGENRCG KTQVCHTLAV TAQLPKSLNG GNGKVCYIDT EGTFRPEKVC       180
     KIAERYGLDG EAVLDNILYA RAFTHEHLYQ LLAISAAKMC EEPFALLVVD SIISLFRVDF       240
     SGRGELSERQ QKLNKTMSIL SKLSEQFNIA ILITNQVMSD PGATMTFIAN PMKPVGGHVI       300
     GHASTIRLSL RKGKGDQRVC KVYDAPNLPE VECIFQLSDK GVIDATD                     347
//

If you have problems or comments...

PBIL Back to PBIL home page