(data stored in SCRATCH zone)

EMBL: AL844507.PE165

AL844507.PE165       Location/Qualifiers
FT   CDS             770946..771773
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0816900"
FT                   /product="adenylate kinase 2"
FT                   /EC_number="2.7.4.3"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0816900"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0062:mRNA"
FT                   /db_xref="GOA:Q8IB06"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB06"
FT                   /protein_id="CAD51204.1"
FT                   /translation="MGSCYSRKNKVSTISLDEEEKKKEKKKKKKIYILNGASGSGKDTQ
FT                   CRLLEKKYNYKIICISKLLKEYKEEYNKENVLNEEENYFDEIEKCMIDGSLVNDQIVIE
FT                   IFHKQLNKYINDDKYNGIIINGFPRNYEQALLIIQNNISITKFINIQVGKDTLWTRINN
FT                   RIIDPITNISYNENIIQIIKKKREGQELSDKEQKQLIIDNHLYNNLSNDILERLTKRKD
FT                   DEEQVFNKRFQLYIESEQKINSLFKNICKNVDGEKSINDIFDQICSIIDDNPN"
     MGSCYSRKNK VSTISLDEEE KKKEKKKKKK IYILNGASGS GKDTQCRLLE KKYNYKIICI        60
     SKLLKEYKEE YNKENVLNEE ENYFDEIEKC MIDGSLVNDQ IVIEIFHKQL NKYINDDKYN       120
     GIIINGFPRN YEQALLIIQN NISITKFINI QVGKDTLWTR INNRIIDPIT NISYNENIIQ       180
     IIKKKREGQE LSDKEQKQLI IDNHLYNNLS NDILERLTKR KDDEEQVFNK RFQLYIESEQ       240
     KINSLFKNIC KNVDGEKSIN DIFDQICSII DDNPN                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page