(data stored in ACNUC9543 zone)

EMBL: AL844507.PE166

AL844507.PE166       Location/Qualifiers
FT   CDS             772568..773737
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0817000"
FT                   /product="NEDD8-activating enzyme E1 catalytic subunit,
FT                   putative"
FT                   /EC_number="6.2.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0817000"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.75:mRNA"
FT                   /db_xref="GOA:C0H4V1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR023318"
FT                   /db_xref="InterPro:IPR030468"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4V1"
FT                   /protein_id="CAX64128.1"
FT                   /translation="MDKLICTKSFERLNILVVGCGGLGNEVIKNLIFLHIKNICIVDYD
FT                   IVEVSNLQRQLFFSHDDIGKYKVDVISYKIKETYMHENICIKSYKNHIEEFDTSFFEDF
FT                   DYIIGCLDNIKGRIYLNNIIYNLRKDIIYIDGGIEGFKGNVKIINRKKNYACIQCSIEN
FT                   YTNSTYPMCSIINNPKTPEECILYVLNVSFKKEKHEELNINNIQHIQWVYEEAKKRAQY
FT                   FHIENVTYNLTEQVITNTIPTTISTLMIISSLIINILYKLVLYKNENFPYSDILYVGDN
FT                   GIYTYYYHIYKDPQCVICNKKKINFTLHKNYTLNDLIELIKRTYLCEKINISSDTCILY
FT                   ISSKCVSKIYNHKLQLTLSQLIDMGQIKENGYLNIQTDKSNYILFFNLV"
     MDKLICTKSF ERLNILVVGC GGLGNEVIKN LIFLHIKNIC IVDYDIVEVS NLQRQLFFSH        60
     DDIGKYKVDV ISYKIKETYM HENICIKSYK NHIEEFDTSF FEDFDYIIGC LDNIKGRIYL       120
     NNIIYNLRKD IIYIDGGIEG FKGNVKIINR KKNYACIQCS IENYTNSTYP MCSIINNPKT       180
     PEECILYVLN VSFKKEKHEE LNINNIQHIQ WVYEEAKKRA QYFHIENVTY NLTEQVITNT       240
     IPTTISTLMI ISSLIINILY KLVLYKNENF PYSDILYVGD NGIYTYYYHI YKDPQCVICN       300
     KKKINFTLHK NYTLNDLIEL IKRTYLCEKI NISSDTCILY ISSKCVSKIY NHKLQLTLSQ       360
     LIDMGQIKEN GYLNIQTDKS NYILFFNLV                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page