(data stored in ACNUC9543 zone)

EMBL: AL844507.PE168

AL844507.PE168       Location/Qualifiers
FT   CDS             complement(777257..779647)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0817200"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0817200"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0061:mRNA"
FT                   /db_xref="GOA:Q8IB08"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB08"
FT                   /protein_id="CAD51202.1"
FT                   /translation="MVVKKISGDIIQHYVGKNDFKRKCFKTLDICKNNKSTLRIIDLKS
FT                   YVKNLILGLSNDELSRYQNMFNKINKRNNKYNNLFYNISKDCNNKIQMNGKKKSSNIQN
FT                   VCKYNCDMQNKNSLFNYDIMYRNNISIFLKRRNNFHTLNKIFRKGNDVIQDNTKCKEYK
FT                   NSINNMKMNKKDEFNINNDINKNDSNNKIYEIYEILHKYEKSINFYKYMFIMNSLVVIL
FT                   ILCGLFVFTGDIINKYIINKIEKVLEDIKNSKEIENNLKEIINSLIYNVVVQEKNKMIT
FT                   SAFFIDVLKNSRKDMENVFIDILETEQVKNKLRNVFQDISIYLCNNKEVQKKVAYLLAE
FT                   AIHLPVSISISKKWLNDLFNSEEVTQNMRNIIYKELFKNDEMINHSIGYLQYILLNTLQ
FT                   NKNTHEMTKLFLNSILSNQEFQIQLSENVWKIFKLALSPKWMNNEDFKIVLKDSRGVEK
FT                   IIKKEFNVNNKNVNTISCEMDNTINSNGNYSSTDHLSLINKNFSSDENNSINNHRCDDK
FT                   NNYKYDDKNNYKYDDKNNYKYDDTKNHNDDSAYMSVVASEEAKTKMNIKYIDEKLNKDK
FT                   IKYIDNLKNTEKKKSIDGNIFIPLNYPINHTCNDHRMCNICQHFNQKLKNEIKFILHIF
FT                   QNYDENNEKNIRTNNNSISIKPYENQNNLNFNQEVNKTLQLNIITDTLKSLLNSSHIFF
FT                   DKTILRIPTYKIQNVHEMHAKFTYPFLLNIFKHMNTNTDKKKSQSTQDNLNPIQKVIYK
FT                   YSLKEKLYLNLVDMFLFYSYKYYFYYYYVIKLKYILYDHFKDK"
     MVVKKISGDI IQHYVGKNDF KRKCFKTLDI CKNNKSTLRI IDLKSYVKNL ILGLSNDELS        60
     RYQNMFNKIN KRNNKYNNLF YNISKDCNNK IQMNGKKKSS NIQNVCKYNC DMQNKNSLFN       120
     YDIMYRNNIS IFLKRRNNFH TLNKIFRKGN DVIQDNTKCK EYKNSINNMK MNKKDEFNIN       180
     NDINKNDSNN KIYEIYEILH KYEKSINFYK YMFIMNSLVV ILILCGLFVF TGDIINKYII       240
     NKIEKVLEDI KNSKEIENNL KEIINSLIYN VVVQEKNKMI TSAFFIDVLK NSRKDMENVF       300
     IDILETEQVK NKLRNVFQDI SIYLCNNKEV QKKVAYLLAE AIHLPVSISI SKKWLNDLFN       360
     SEEVTQNMRN IIYKELFKND EMINHSIGYL QYILLNTLQN KNTHEMTKLF LNSILSNQEF       420
     QIQLSENVWK IFKLALSPKW MNNEDFKIVL KDSRGVEKII KKEFNVNNKN VNTISCEMDN       480
     TINSNGNYSS TDHLSLINKN FSSDENNSIN NHRCDDKNNY KYDDKNNYKY DDKNNYKYDD       540
     TKNHNDDSAY MSVVASEEAK TKMNIKYIDE KLNKDKIKYI DNLKNTEKKK SIDGNIFIPL       600
     NYPINHTCND HRMCNICQHF NQKLKNEIKF ILHIFQNYDE NNEKNIRTNN NSISIKPYEN       660
     QNNLNFNQEV NKTLQLNIIT DTLKSLLNSS HIFFDKTILR IPTYKIQNVH EMHAKFTYPF       720
     LLNIFKHMNT NTDKKKSQST QDNLNPIQKV IYKYSLKEKL YLNLVDMFLF YSYKYYFYYY       780
     YVIKLKYILY DHFKDK                                                       796
//

If you have problems or comments...

PBIL Back to PBIL home page