(data stored in ACNUC9543 zone)

EMBL: AL844507.PE169

AL844507.PE169       Location/Qualifiers
FT   CDS             complement(782909..789616)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0817300"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0817300"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0060:mRNA"
FT                   /db_xref="GOA:Q8IB09"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB09"
FT                   /protein_id="CAD51201.1"
FT                   /translation="MEVHLEENKVKNNSSNSSNENNNNDENVSLHAERNNETNCTKGNN
FT                   NDDDKSNNINNNNYNNNYNNNYNNNIYNNNNNNNNNVFFSSDALTNDDATYFAFKNKDN
FT                   LIHDEGMCEFKSQDENFLHAEVSSNEYKDANNDSSDEEDDEYLNQNKNIIVIDDSLPNN
FT                   SNSTFDDKEKTETNNRINIKDELGTTETIVEDLEYNDVIYDTENNKNYIVKSVVDGNKE
FT                   HVEQKENYKFDDNNDDDNNKNDNNNDKNDDHSKNNNNNNNNNNADVSVIVQVDGQENRP
FT                   MIYINDTSAEECNNNNNNNILMNENYNKPNTVNNSSYINNNNLVNINTLNNENKGISNV
FT                   ESYEKNVNEKFDNVNENFESINEPYDSINEPYDNINEGCDNINEGCDNINEGCDNINEG
FT                   CDNINEGCDNINEGCDNINEGCDNINEGCDNINEGCDNINEGCGNINEGCGNINEGCDN
FT                   INKMYNQNSQIKLQQNYKEERNQQMNKNNNIKERTLPMKKEEKKMPPLSHMFDSIVKIK
FT                   KQVDSMKSRKEENNPKGFKKDNRKRRKPKYRFEKDKDGNICDFFMVCSSELKGIKKCRN
FT                   VGLDLQMINVTDIQLTYHFVCKEHDTCEGSVIVIVDIISNNNIEIKGKGPLCINFNDFI
FT                   DEKKKNTGNRFKWEYLDVCGNIQEGKDRATAMGYKYLNSSVTGKRYVRNFVCILNAQCN
FT                   SRLRIIKDNETDKVWLELSGMNHEEHCPYSPHSVEGMFLNNKKNKNQIISSLGNDKFFT
FT                   NNSNILNGVMLNNPNVMNAPHPFNKMNYNYHNMNPGLNNFNSFNNANYAFINMNYNDMN
FT                   IGVNNNSDLNNNNTAATSNNNTHNNNNNNNSNYNPYFMNNYMNSKNHPLYLNSNNNYGN
FT                   DIKMKILPPYMHHFNKAMKIIPEGSSCNVMNMSNGNNNMNQMSHMNDMNNMNNMNNINN
FT                   MNSMNSMNSMNSMNNMNNMNSMNSMNNMNNMNNNNNNNNSGSIVNLGNNNMDISMNSKT
FT                   LYNLSKLSCATNSTTDSSKMSLKRNIWYNNRSNSVHSALNGALNSNMSNNYSDNMLLRS
FT                   SIKNGPKYSVHYPSSSNNQDTTTMSISNKKSVVRNLMLNTQDQNFVLNNMYNNNSSNNN
FT                   TNNSNNTNNTNNSNNSSSSSNNNNTSSATYNNYMSSYGYVNMPTNNNINMNENNVEFNN
FT                   TKKNSVTDNLNNNGNVKDLLTNGNMNNAVYYNKSISSNNNGKDLRNNFYNNSNIDLNKN
FT                   NCYSIDNKQQLANSKFVNNNIYPNYNNMNDMTNNNNNNNNNNNNNNNNNNNNNNNNNNN
FT                   NNNNNNNNNNNNSNNNNDYVHNNINVSTSLGCATGSVMSQGSSTNNMNYNLRNYESKNF
FT                   NSYQNGIISDNSNSNNNSNNNNNNNNNNNNTNSSSSNGLIYHYPNYDKIKTNAPKGILN
FT                   EYKLVKNVRSNSNSLNNKKGSNNTYYNTKTSQNAYQNTILKNSPLVSLSNNSGMMNYNM
FT                   INDMKDENNMNAGNMYTGSISSSNNNNSNNNSNNNNSNSTMTSNGLLYNNMNIINNNNV
FT                   DELNDINNNKVGIPPHHLLDNTSLIKDEMNYNNEENNMVSQHHKVFIGNGHENMLKDNS
FT                   ENLLKHMSNDTKIDENNNNTHIDDKDYNKNNMQLDYSNNNNNNNNKMDHSRNGSGSDDF
FT                   MKRKYKKMNTNFDSNNEHLNDEFKDIDIVDAQNDDTDKLRDINGKYEENNIIIDDINSK
FT                   ERRSINEYNNKCSSTAAYSEMKQYVDVKDTNNHNNNMLSNYLNMTDENNNNNNNNNNNN
FT                   NTYLNDDNVKTTEKKRKFLNTYNDPNVDDMNNNLSHHVGVDYDNHVVDSFNNSSYMYSS
FT                   QMYKYMKSNKYDTCMNTNMENINGTNNNNNNNNNNNNNNNNNNNNNNINRNNVSDNSTN
FT                   IVDNDSYDKTNNSSNGSMYKTNVQNMVNNNNGAATLNKCDSLLNHDMNVSKLNYNSNNN
FT                   NNSNNNSCGVAGGSMDSHYNTANSLMNYNKNHYEDGNDLNNMDTNNNNNNNNNGSNSNN
FT                   SNNSNSSNNNNNKNKNLMGRDSLQDKIMYNPMNDYNCIYPSNNPYGIQNNDKGYMYPNY
FT                   NTALNIMNPNENGDNNNSMVGASVMDNYNNNNLYMNNNNNNNNNNNNYLNNYMNPTDNM
FT                   KNMSKNNNGSYNTSLQNLNGLEGTTNNAAVTQPANNLNNYSNLNNNNNNNLTMFNCDLA
FT                   SNPYKNDLTCSYNNNGTANSNYYYMNNGYDNSSYQYNLANGNMMYDMNNRSMDASNNQN
FT                   DYYNQNY"
     MEVHLEENKV KNNSSNSSNE NNNNDENVSL HAERNNETNC TKGNNNDDDK SNNINNNNYN        60
     NNYNNNYNNN IYNNNNNNNN NVFFSSDALT NDDATYFAFK NKDNLIHDEG MCEFKSQDEN       120
     FLHAEVSSNE YKDANNDSSD EEDDEYLNQN KNIIVIDDSL PNNSNSTFDD KEKTETNNRI       180
     NIKDELGTTE TIVEDLEYND VIYDTENNKN YIVKSVVDGN KEHVEQKENY KFDDNNDDDN       240
     NKNDNNNDKN DDHSKNNNNN NNNNNADVSV IVQVDGQENR PMIYINDTSA EECNNNNNNN       300
     ILMNENYNKP NTVNNSSYIN NNNLVNINTL NNENKGISNV ESYEKNVNEK FDNVNENFES       360
     INEPYDSINE PYDNINEGCD NINEGCDNIN EGCDNINEGC DNINEGCDNI NEGCDNINEG       420
     CDNINEGCDN INEGCDNINE GCGNINEGCG NINEGCDNIN KMYNQNSQIK LQQNYKEERN       480
     QQMNKNNNIK ERTLPMKKEE KKMPPLSHMF DSIVKIKKQV DSMKSRKEEN NPKGFKKDNR       540
     KRRKPKYRFE KDKDGNICDF FMVCSSELKG IKKCRNVGLD LQMINVTDIQ LTYHFVCKEH       600
     DTCEGSVIVI VDIISNNNIE IKGKGPLCIN FNDFIDEKKK NTGNRFKWEY LDVCGNIQEG       660
     KDRATAMGYK YLNSSVTGKR YVRNFVCILN AQCNSRLRII KDNETDKVWL ELSGMNHEEH       720
     CPYSPHSVEG MFLNNKKNKN QIISSLGNDK FFTNNSNILN GVMLNNPNVM NAPHPFNKMN       780
     YNYHNMNPGL NNFNSFNNAN YAFINMNYND MNIGVNNNSD LNNNNTAATS NNNTHNNNNN       840
     NNSNYNPYFM NNYMNSKNHP LYLNSNNNYG NDIKMKILPP YMHHFNKAMK IIPEGSSCNV       900
     MNMSNGNNNM NQMSHMNDMN NMNNMNNINN MNSMNSMNSM NSMNNMNNMN SMNSMNNMNN       960
     MNNNNNNNNS GSIVNLGNNN MDISMNSKTL YNLSKLSCAT NSTTDSSKMS LKRNIWYNNR      1020
     SNSVHSALNG ALNSNMSNNY SDNMLLRSSI KNGPKYSVHY PSSSNNQDTT TMSISNKKSV      1080
     VRNLMLNTQD QNFVLNNMYN NNSSNNNTNN SNNTNNTNNS NNSSSSSNNN NTSSATYNNY      1140
     MSSYGYVNMP TNNNINMNEN NVEFNNTKKN SVTDNLNNNG NVKDLLTNGN MNNAVYYNKS      1200
     ISSNNNGKDL RNNFYNNSNI DLNKNNCYSI DNKQQLANSK FVNNNIYPNY NNMNDMTNNN      1260
     NNNNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNNNSNNN NDYVHNNINV STSLGCATGS      1320
     VMSQGSSTNN MNYNLRNYES KNFNSYQNGI ISDNSNSNNN SNNNNNNNNN NNNTNSSSSN      1380
     GLIYHYPNYD KIKTNAPKGI LNEYKLVKNV RSNSNSLNNK KGSNNTYYNT KTSQNAYQNT      1440
     ILKNSPLVSL SNNSGMMNYN MINDMKDENN MNAGNMYTGS ISSSNNNNSN NNSNNNNSNS      1500
     TMTSNGLLYN NMNIINNNNV DELNDINNNK VGIPPHHLLD NTSLIKDEMN YNNEENNMVS      1560
     QHHKVFIGNG HENMLKDNSE NLLKHMSNDT KIDENNNNTH IDDKDYNKNN MQLDYSNNNN      1620
     NNNNKMDHSR NGSGSDDFMK RKYKKMNTNF DSNNEHLNDE FKDIDIVDAQ NDDTDKLRDI      1680
     NGKYEENNII IDDINSKERR SINEYNNKCS STAAYSEMKQ YVDVKDTNNH NNNMLSNYLN      1740
     MTDENNNNNN NNNNNNNTYL NDDNVKTTEK KRKFLNTYND PNVDDMNNNL SHHVGVDYDN      1800
     HVVDSFNNSS YMYSSQMYKY MKSNKYDTCM NTNMENINGT NNNNNNNNNN NNNNNNNNNN      1860
     NNINRNNVSD NSTNIVDNDS YDKTNNSSNG SMYKTNVQNM VNNNNGAATL NKCDSLLNHD      1920
     MNVSKLNYNS NNNNNSNNNS CGVAGGSMDS HYNTANSLMN YNKNHYEDGN DLNNMDTNNN      1980
     NNNNNNGSNS NNSNNSNSSN NNNNKNKNLM GRDSLQDKIM YNPMNDYNCI YPSNNPYGIQ      2040
     NNDKGYMYPN YNTALNIMNP NENGDNNNSM VGASVMDNYN NNNLYMNNNN NNNNNNNNYL      2100
     NNYMNPTDNM KNMSKNNNGS YNTSLQNLNG LEGTTNNAAV TQPANNLNNY SNLNNNNNNN      2160
     LTMFNCDLAS NPYKNDLTCS YNNNGTANSN YYYMNNGYDN SSYQYNLANG NMMYDMNNRS      2220
     MDASNNQNDY YNQNY                                                       2235
//

If you have problems or comments...

PBIL Back to PBIL home page