(data stored in ACNUC9543 zone)

EMBL: AL844507.PE171

AL844507.PE171       Location/Qualifiers
FT   CDS             join(798777..798807,799031..799136,799409..799503,
FT                   799639..799691,799804..799938,800068..800205)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0817500"
FT                   /product="histidine triad nucleotide-binding protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0817500"
FT                   /db_xref="GOA:Q7K6B1"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:Q7K6B1"
FT                   /protein_id="CAD51199.2"
FT                   /translation="MGFKIVFIYLIFVCLMKIIPGFFTNKLTNSFYSTFVKLSYKNKFM
FT                   TGILTRRLAKMADEEERALEAAGKDENGDSIFGKIARGEVPVDAVYEDDKVIAFNDIYP
FT                   QAPVHIIVIPKRRDGLTRLSKAEEKHKEILGHLMWAVAEIVRKNNLGDFRLVVNNGPEA
FT                   CQSIYYLHLHILAKRQMKWPPG"
     MGFKIVFIYL IFVCLMKIIP GFFTNKLTNS FYSTFVKLSY KNKFMTGILT RRLAKMADEE        60
     ERALEAAGKD ENGDSIFGKI ARGEVPVDAV YEDDKVIAFN DIYPQAPVHI IVIPKRRDGL       120
     TRLSKAEEKH KEILGHLMWA VAEIVRKNNL GDFRLVVNNG PEACQSIYYL HLHILAKRQM       180
     KWPPG                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page