(data stored in SCRATCH zone)

EMBL: AL844507.PE172

AL844507.PE172       Location/Qualifiers
FT   CDS             complement(join(800920..803696,803923..804034))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0817600"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0817600"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0058:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB11"
FT                   /protein_id="CAD51198.1"
FT                   /translation="MSSEVSAQIIKEDGFPKKTMNPPKKFPLLLKNKGKSPPFIQKNNI
FT                   TNNRDNDINVEGINSDISNKKFPPKLKAMKPKIKIPEPKFKAIEMKSDEKQSNMNNVQN
FT                   DMKKIMPKLKSIKPKIKIPEPKFKSLEQTIKKGESYIKSSNTNKEPPKSIMKQSSTNSN
FT                   NSQPILKRLQTSKKKVSIDLVDEEDDISNEKNFNKNSLFKNKYYSKINIIDKLKNVCSN
FT                   EINKNESNGSTKDPMGIGKIYYSIKEKGKAFQPSFSSSIKEKTITNIGTASFSQELAKQ
FT                   NIGSNQHMKRDNMSRNDPSNDIQNNSNNGPKRMSMEKISKNDNILENNTNVRQKSESHI
FT                   KMSNTCGENILVGIKGNKSNIGPLTTFNESKLIQDTHYINAFSRFSGNYVGKVTGPANS
FT                   ISNFDKTPQNMNDKKTCVQNGIHNNGYVCKGVPPPFYEYPYMMNYPYCNNVLYNGGMDN
FT                   HPFYFYPRFYLPMYPYDYPHNETVPFFNDENVIPNGNHISAAHKTTRRNKRDERNKHKG
FT                   KNNKFEDNMIIAGGHLKPLQFRNGAEWSKKNDQKKFNDGEEVYYDDDNYDSYDDVDEEE
FT                   YFDWDEYNNEDKFYEEQNKIKHKQKSSYIGNSKWYEIEQKLNNCRGVIEDDKPPKEIII
FT                   KKKKSVNEKKKKKPYYEEETKYYDEYESEYSYTYDGEYNDVYISDDQLINPKMYKNGVY
FT                   NRRRLSNRNEKHGLEQNTLEDTYNFNFDDIYKNYRIEYLNEKLKWANEHLKKKKNNKYK
FT                   KNQKDEITIDQDKANDPTLIQGPRKKNLERLEDIAHLFLPKQKKHDNMFNLSLNISKMS
FT                   NNDKNDIINMLFSCRELEKLIEEQHCVLDMLDNDLREVNASLKLPATWDNLENFELLQE
FT                   NILKEDEQGLPINNTPFFIKGKVALIPKDINTFFDDEKKGESTGKKDYYARQVVQMATQ
FT                   VNTPTPVKYVPKFTKAKVKPKVPLLLKNITKA"
     MSSEVSAQII KEDGFPKKTM NPPKKFPLLL KNKGKSPPFI QKNNITNNRD NDINVEGINS        60
     DISNKKFPPK LKAMKPKIKI PEPKFKAIEM KSDEKQSNMN NVQNDMKKIM PKLKSIKPKI       120
     KIPEPKFKSL EQTIKKGESY IKSSNTNKEP PKSIMKQSST NSNNSQPILK RLQTSKKKVS       180
     IDLVDEEDDI SNEKNFNKNS LFKNKYYSKI NIIDKLKNVC SNEINKNESN GSTKDPMGIG       240
     KIYYSIKEKG KAFQPSFSSS IKEKTITNIG TASFSQELAK QNIGSNQHMK RDNMSRNDPS       300
     NDIQNNSNNG PKRMSMEKIS KNDNILENNT NVRQKSESHI KMSNTCGENI LVGIKGNKSN       360
     IGPLTTFNES KLIQDTHYIN AFSRFSGNYV GKVTGPANSI SNFDKTPQNM NDKKTCVQNG       420
     IHNNGYVCKG VPPPFYEYPY MMNYPYCNNV LYNGGMDNHP FYFYPRFYLP MYPYDYPHNE       480
     TVPFFNDENV IPNGNHISAA HKTTRRNKRD ERNKHKGKNN KFEDNMIIAG GHLKPLQFRN       540
     GAEWSKKNDQ KKFNDGEEVY YDDDNYDSYD DVDEEEYFDW DEYNNEDKFY EEQNKIKHKQ       600
     KSSYIGNSKW YEIEQKLNNC RGVIEDDKPP KEIIIKKKKS VNEKKKKKPY YEEETKYYDE       660
     YESEYSYTYD GEYNDVYISD DQLINPKMYK NGVYNRRRLS NRNEKHGLEQ NTLEDTYNFN       720
     FDDIYKNYRI EYLNEKLKWA NEHLKKKKNN KYKKNQKDEI TIDQDKANDP TLIQGPRKKN       780
     LERLEDIAHL FLPKQKKHDN MFNLSLNISK MSNNDKNDII NMLFSCRELE KLIEEQHCVL       840
     DMLDNDLREV NASLKLPATW DNLENFELLQ ENILKEDEQG LPINNTPFFI KGKVALIPKD       900
     INTFFDDEKK GESTGKKDYY ARQVVQMATQ VNTPTPVKYV PKFTKAKVKP KVPLLLKNIT       960
     KA                                                                      962
//

If you have problems or comments...

PBIL Back to PBIL home page