(data stored in ACNUC9543 zone)

EMBL: AL844507.PE173

AL844507.PE173       Location/Qualifiers
FT   CDS             complement(join(805797..805909,806037..806138,
FT                   806258..806320,806418..806489,806606..806680,
FT                   806840..806905,806995..807039,807147..807203,
FT                   807343..807375,807506..807535,807633..807665,
FT                   807804..807842,807982..808056,808155..808373,
FT                   808550..808927,809059..809433,809657..810047,
FT                   810247..810440,810565..810687,810802..810882,
FT                   810973..811095,811240..811320,811463..811528,
FT                   811726..811800,811902..811961,812115..812303,
FT                   812452..812478,812655..812687,812972..813085,
FT                   813221..813298,813405..813465))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0817700"
FT                   /product="rhoptry neck protein 5"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0817700"
FT                   /db_xref="GOA:C0H4V4"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4V4"
FT                   /protein_id="CAX64131.1"
FT                   /translation="MLKYTLLIYIIAGYFISEISNKLFDTLLPRNVFKKPKPFKKNEIK
FT                   KGIDKDEKSIMKNVDSIDVMFEPRVKRFVPSRTRKTHVVGGLSQSIPDPGDVEKSKYEK
FT                   AVRFFENIKNEMINMSSKINKQLDSQDISSLNNFKRASEVLKESLATMHSLDIIRNDGS
FT                   VDFSKYTLDWYSKANMREKYSIEKSIQKIMNKLFKKARKKKKNMKKKKIDANIEQLEMD
FT                   LLVQKFITENLNASKLLKLYDDSANDYVSPMHTDVCGQLGSIIFSYMFEKAYKSSINHD
FT                   ISYFQKYLPRLKYRIQNMIQKGTLLLLEKGLDDSLYTFKSKISDIMEKKFGFNDMCTDK
FT                   CMDETIKADYDLSEYKNEFSPSKTAQRRADLVKLLMYYYRDKIYNIETSADVVLIMLLY
FT                   LNSANELSEKGYLDVSSISTDDEFNLINKTIDRSHKFNKKIKIKKKTFFKIAPFNFFRE
FT                   ETQEKTGNESIFAIDDIIKTSLLAKKSQNYNSLYETTKDLWNQIQNMYSASYGFVQSKK
FT                   IKTNKFVGSKIRNVGFLLRWFNYNKTPSKNINFLVNNFSPLVSISLQLVFFITTMIEQY
FT                   ESSFLGNFSSALKKIFTLGKSGRNPRNYNDLVNFSEVDYLLRTSKANNVQRIIMQIIRM
FT                   LKKKFLSSSYTPTLLAQYMSIFLSLWVFEGENNISLQNPNISRFKKIFFLTYFVHEKGP
FT                   VEKAVDIIYNKCRMKTDKIVLGCIHDYGGREKKKLLGLISRKCKPTKISIRKRSIRKIL
FT                   NKLMSSLNDPVDILRIAVDTATRCDHFNRSKNIDNVKTKKNKINYEIFVKSELSIRYIC
FT                   ADVTKNVVKKIIRDVSRLKNMREAQNVIDNGLNSVQYLKIRNYRDKESSFTILCPFMEG
FT                   NDKNIRELERTQISLFIHKNIGMSRIIKGKLINIFKKTLNMREGIKSDSAISIKVGARK
FT                   YNGIIFTGGYQLNVDNLDQNTLHIGLSKTRKVYDGRKYVDELEILKGDGVKNIYMKGLN
FT                   EDNERIYELQNNMRVSEFDYAIQNPEANIIVFDGNNYISSYALRNMGLEHERIVWAGPS
FT                   VGWTAEFALSAISDNPLPIFDGSAWVLLEKLSIRSILGKHLPSDVNGNSLANTVNFVIL
FT                   NKDGKPILKNTTPVINLKYATFTLSGIVNFVIKAEKGIGNEIIVHTRIP"
     MLKYTLLIYI IAGYFISEIS NKLFDTLLPR NVFKKPKPFK KNEIKKGIDK DEKSIMKNVD        60
     SIDVMFEPRV KRFVPSRTRK THVVGGLSQS IPDPGDVEKS KYEKAVRFFE NIKNEMINMS       120
     SKINKQLDSQ DISSLNNFKR ASEVLKESLA TMHSLDIIRN DGSVDFSKYT LDWYSKANMR       180
     EKYSIEKSIQ KIMNKLFKKA RKKKKNMKKK KIDANIEQLE MDLLVQKFIT ENLNASKLLK       240
     LYDDSANDYV SPMHTDVCGQ LGSIIFSYMF EKAYKSSINH DISYFQKYLP RLKYRIQNMI       300
     QKGTLLLLEK GLDDSLYTFK SKISDIMEKK FGFNDMCTDK CMDETIKADY DLSEYKNEFS       360
     PSKTAQRRAD LVKLLMYYYR DKIYNIETSA DVVLIMLLYL NSANELSEKG YLDVSSISTD       420
     DEFNLINKTI DRSHKFNKKI KIKKKTFFKI APFNFFREET QEKTGNESIF AIDDIIKTSL       480
     LAKKSQNYNS LYETTKDLWN QIQNMYSASY GFVQSKKIKT NKFVGSKIRN VGFLLRWFNY       540
     NKTPSKNINF LVNNFSPLVS ISLQLVFFIT TMIEQYESSF LGNFSSALKK IFTLGKSGRN       600
     PRNYNDLVNF SEVDYLLRTS KANNVQRIIM QIIRMLKKKF LSSSYTPTLL AQYMSIFLSL       660
     WVFEGENNIS LQNPNISRFK KIFFLTYFVH EKGPVEKAVD IIYNKCRMKT DKIVLGCIHD       720
     YGGREKKKLL GLISRKCKPT KISIRKRSIR KILNKLMSSL NDPVDILRIA VDTATRCDHF       780
     NRSKNIDNVK TKKNKINYEI FVKSELSIRY ICADVTKNVV KKIIRDVSRL KNMREAQNVI       840
     DNGLNSVQYL KIRNYRDKES SFTILCPFME GNDKNIRELE RTQISLFIHK NIGMSRIIKG       900
     KLINIFKKTL NMREGIKSDS AISIKVGARK YNGIIFTGGY QLNVDNLDQN TLHIGLSKTR       960
     KVYDGRKYVD ELEILKGDGV KNIYMKGLNE DNERIYELQN NMRVSEFDYA IQNPEANIIV      1020
     FDGNNYISSY ALRNMGLEHE RIVWAGPSVG WTAEFALSAI SDNPLPIFDG SAWVLLEKLS      1080
     IRSILGKHLP SDVNGNSLAN TVNFVILNKD GKPILKNTTP VINLKYATFT LSGIVNFVIK      1140
     AEKGIGNEII VHTRIP                                                      1156
//

If you have problems or comments...

PBIL Back to PBIL home page