(data stored in ACNUC9543 zone)

EMBL: AL844507.PE174

AL844507.PE174       Location/Qualifiers
FT   CDS             join(815150..815293,815431..815451)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0817800"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0817800"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0057:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB13"
FT                   /protein_id="CAD51196.1"
FT                   /translation="MSYGCGTVGLPFIGKALLFFMSVEATYCTYELFLKPGGTYVYYRI
FT                   NDMLNKDKK"
     MSYGCGTVGL PFIGKALLFF MSVEATYCTY ELFLKPGGTY VYYRINDMLN KDKK              54
//

If you have problems or comments...

PBIL Back to PBIL home page