(data stored in SCRATCH zone)

EMBL: AL844507.PE177

AL844507.PE177       Location/Qualifiers
FT   CDS             join(824564..826102,826441..826518)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0818100"
FT                   /product="zinc finger protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0818100"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.70:mRNA"
FT                   /db_xref="GOA:Q8IB16"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB16"
FT                   /protein_id="CAD51193.2"
FT                   /translation="MACTPLLSEEDLYRFRTKQCLRLAKGLCEFGLDRCQYSHSAEWIR
FT                   RCPYYISLPSYLRYIPVACPYFIKNKNETEEDIEKRNMILKNCVHLTNKDGSVNNKFYK
FT                   YIEETNINKCPLGVECPLAHSIDEIDYHPLVYKTKRCENYMHANCNKYYCNNLHGLAEQ
FT                   RKIKEYFIPYSNKIDIPAYPNVTIVSKIQYGSFKGQTQLSNNQKKMNTDFNLNSRNFNY
FT                   PCKMINGKNYKHIDLKYNSINLPCQQRYTLQEQKMNQPKRYTTSNLMNMQPSHPNFSFS
FT                   CENQLKNKKKNSIFSYLNNFDDKFTLYLHILKKFPYLFDLNISDMNNENSGSFIRTQEL
FT                   TDNSSKGNLIDLTNMTNMKNDDNIGISSKNNIQDIYEKEFSKNNSQSINDSQNKYNTFE
FT                   QCTENIFMNNSYCEILNHIFKKNLQITKNKITCENATQRSFNDMEKYYTKNSSDNVDLD
FT                   FIRNLNGNYLNADNKIETYDDVLNMLSHILCLLYFTSDSRAHATFDTYAHKLAKQLNFE
FT                   SRKRKEMSIPKYLNYNMKEMI"
     MACTPLLSEE DLYRFRTKQC LRLAKGLCEF GLDRCQYSHS AEWIRRCPYY ISLPSYLRYI        60
     PVACPYFIKN KNETEEDIEK RNMILKNCVH LTNKDGSVNN KFYKYIEETN INKCPLGVEC       120
     PLAHSIDEID YHPLVYKTKR CENYMHANCN KYYCNNLHGL AEQRKIKEYF IPYSNKIDIP       180
     AYPNVTIVSK IQYGSFKGQT QLSNNQKKMN TDFNLNSRNF NYPCKMINGK NYKHIDLKYN       240
     SINLPCQQRY TLQEQKMNQP KRYTTSNLMN MQPSHPNFSF SCENQLKNKK KNSIFSYLNN       300
     FDDKFTLYLH ILKKFPYLFD LNISDMNNEN SGSFIRTQEL TDNSSKGNLI DLTNMTNMKN       360
     DDNIGISSKN NIQDIYEKEF SKNNSQSIND SQNKYNTFEQ CTENIFMNNS YCEILNHIFK       420
     KNLQITKNKI TCENATQRSF NDMEKYYTKN SSDNVDLDFI RNLNGNYLNA DNKIETYDDV       480
     LNMLSHILCL LYFTSDSRAH ATFDTYAHKL AKQLNFESRK RKEMSIPKYL NYNMKEMI         538
//

If you have problems or comments...

PBIL Back to PBIL home page