(data stored in ACNUC9543 zone)

EMBL: AL844507.PE178

AL844507.PE178       Location/Qualifiers
FT   CDS             join(830006..830090,830386..830471,830614..831202,
FT                   831426..831454)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0818200"
FT                   /product="14-3-3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0818200"
FT                   /db_xref="GOA:C0H4V6"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="InterPro:IPR036815"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4V6"
FT                   /protein_id="CAX64133.1"
FT                   /translation="MATSEELKQLRCDCTYRSKLAEQAERYDEMADAMRTLVEQCVNND
FT                   KDELTVEERNLLSVAYKNAVGARRASWRIISSVEQKEMSKANVHNKNVAATYRKKVEEE
FT                   LNNICQDILNLLTKKLIPNTSESESKVFYYKMKGDYYRYISEFSCDEGKKEASNCAQEA
FT                   YQKATDIAENELPSTHPIRLGLALNYSVFFYEILNQPHQACEMAKRAFDDAITEFDNVS
FT                   EDSYKDSTLIMQLLRDNLTLWTSDLQGDQTEEKSKDEGLE"
     MATSEELKQL RCDCTYRSKL AEQAERYDEM ADAMRTLVEQ CVNNDKDELT VEERNLLSVA        60
     YKNAVGARRA SWRIISSVEQ KEMSKANVHN KNVAATYRKK VEEELNNICQ DILNLLTKKL       120
     IPNTSESESK VFYYKMKGDY YRYISEFSCD EGKKEASNCA QEAYQKATDI AENELPSTHP       180
     IRLGLALNYS VFFYEILNQP HQACEMAKRA FDDAITEFDN VSEDSYKDST LIMQLLRDNL       240
     TLWTSDLQGD QTEEKSKDEG LE                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page