(data stored in ACNUC9543 zone)

EMBL: AL844507.PE179

AL844507.PE179       Location/Qualifiers
FT   CDS             join(833185..833884,834119..834919,835035..835171,
FT                   835290..835334)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0818300"
FT                   /product="dynactin subunit 6, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0818300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.68:mRNA"
FT                   /db_xref="GOA:Q8IB18"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR027777"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB18"
FT                   /protein_id="CAD51191.2"
FT                   /translation="MNKGTIVKLHSLNLDRNINKNVAFNRKGINNYESDLSISSYKTFK
FT                   NSSDNNDIPLYRTCTNDSDHSIKNKDIYGYKKVVSLNEYIFKFKKLTNEKNKNTLDKCN
FT                   IFRRFNTNQNNLINISDSCSESNLSSEGNVSMGVATNMMKKKKIRQNINEGMEDIFCLY
FT                   DKGKHFNYNNYDTIKDITKYKSHIQMEDKPLSCYLNSSFKLMSDNLNCDEKDNTKKTSF
FT                   QIVNDVIWEKRGLITCSNGYILDRDVIKNSEEKKSLKKKVKKYFKHKKSFLQSVKKKRI
FT                   KKYKTVLYNSIHNENKIFVRNPRLSIRDINLYNIKHGKKKNKRIFVFLNGINNIYHSFR
FT                   RKNQNYICNNKNKTCIIMKYNIRNDFINSYEKHLNKKIDNNIFFEIEQNNIKHDIDDNI
FT                   KKPNVEYIKDELNNKESISFYELHKNKNIIIGKRNIIFPSCYMKCDKAKIVIGENNLFE
FT                   DLVTIINNTSTDMYIGSYNIFRSGTYIYNSMKIGDRNCFDYKCNIIKSNIGSHTFIGIN
FT                   MMIDKKWRLRNDHKIVDNVVIYLNSQIIQENMREIISRYNQIK"
     MNKGTIVKLH SLNLDRNINK NVAFNRKGIN NYESDLSISS YKTFKNSSDN NDIPLYRTCT        60
     NDSDHSIKNK DIYGYKKVVS LNEYIFKFKK LTNEKNKNTL DKCNIFRRFN TNQNNLINIS       120
     DSCSESNLSS EGNVSMGVAT NMMKKKKIRQ NINEGMEDIF CLYDKGKHFN YNNYDTIKDI       180
     TKYKSHIQME DKPLSCYLNS SFKLMSDNLN CDEKDNTKKT SFQIVNDVIW EKRGLITCSN       240
     GYILDRDVIK NSEEKKSLKK KVKKYFKHKK SFLQSVKKKR IKKYKTVLYN SIHNENKIFV       300
     RNPRLSIRDI NLYNIKHGKK KNKRIFVFLN GINNIYHSFR RKNQNYICNN KNKTCIIMKY       360
     NIRNDFINSY EKHLNKKIDN NIFFEIEQNN IKHDIDDNIK KPNVEYIKDE LNNKESISFY       420
     ELHKNKNIII GKRNIIFPSC YMKCDKAKIV IGENNLFEDL VTIINNTSTD MYIGSYNIFR       480
     SGTYIYNSMK IGDRNCFDYK CNIIKSNIGS HTFIGINMMI DKKWRLRNDH KIVDNVVIYL       540
     NSQIIQENMR EIISRYNQIK                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page