(data stored in ACNUC9543 zone)

EMBL: AL844507.PE180

AL844507.PE180       Location/Qualifiers
FT   CDS             complement(join(835978..836571,836846..836848))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0818400"
FT                   /product="rRNA-processing protein FCF1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0818400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.67:mRNA"
FT                   /db_xref="GOA:C0H4V7"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR037503"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4V7"
FT                   /protein_id="CAX64134.1"
FT                   /translation="MGKFKKTQKIVKLKRVINPNDKRIIQNNKIKQAEEEKKKKKKESE
FT                   KLKQIEVIDSNLFFNYNENLCPPYNIILDTNFINSSIQYKIDIIKGCSEVLLAKCNIFV
FT                   TDCVIGEMEKLGQRYSLGLKLIKDPRFKRLTCNHKGTYADDCIVNRVTESRCYIIATND
FT                   RDLKIRLRKIPGVPILYAKNFKYKIERLPDNILIS"
     MGKFKKTQKI VKLKRVINPN DKRIIQNNKI KQAEEEKKKK KKESEKLKQI EVIDSNLFFN        60
     YNENLCPPYN IILDTNFINS SIQYKIDIIK GCSEVLLAKC NIFVTDCVIG EMEKLGQRYS       120
     LGLKLIKDPR FKRLTCNHKG TYADDCIVNR VTESRCYIIA TNDRDLKIRL RKIPGVPILY       180
     AKNFKYKIER LPDNILIS                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page