(data stored in ACNUC9543 zone)

EMBL: AL844507.PE181

AL844507.PE181       Location/Qualifiers
FT   CDS             join(842317..842343,842667..843215)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0818500"
FT                   /product="zinc finger protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0818500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0056:mRNA"
FT                   /db_xref="GOA:Q8IB20"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR002653"
FT                   /db_xref="InterPro:IPR035896"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB20"
FT                   /protein_id="CAD51189.1"
FT                   /translation="MSSEKNATTPTPILCENNCGFYGNPANNNLCSKCYREFQEKKKKE
FT                   ISEGEKMNDKNMNDTLNNYNNKISEIIEPTFVNEKQTENEKNSYIKEENSSIINNEQNK
FT                   ESEMQPVTLDNTEEKDNSSQPVEDKSKCFFCSKRIGLVGIKCRCNHYFCSLHRYADAHN
FT                   CTFDYKNYHKQQLIKNNVKVVADKVEKI"
     MSSEKNATTP TPILCENNCG FYGNPANNNL CSKCYREFQE KKKKEISEGE KMNDKNMNDT        60
     LNNYNNKISE IIEPTFVNEK QTENEKNSYI KEENSSIINN EQNKESEMQP VTLDNTEEKD       120
     NSSQPVEDKS KCFFCSKRIG LVGIKCRCNH YFCSLHRYAD AHNCTFDYKN YHKQQLIKNN       180
     VKVVADKVEK I                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page