(data stored in ACNUC9543 zone)

EMBL: AL844507.PE182

AL844507.PE182       Location/Qualifiers
FT   CDS             complement(join(845253..845432,845597..845638,
FT                   845737..845913,846011..846062,846167..846277,
FT                   846385..846463,846594..846661,846785..846839,
FT                   846938..846970,847117..847161,847314..847380))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0818600"
FT                   /product="BEM46-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0818600"
FT                   /db_xref="GOA:A0A143ZYA4"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZYA4"
FT                   /protein_id="CZT62756.1"
FT                   /translation="MRIIKYIFFAFIILALFVCALNTYIYLKQDSFVFSNEFPTVEEKN
FT                   QTLGENYEIVTLTTKDNHKFTCWYIKTKDSENKPIMLYFQGNGGYLEKYMNLFNLIIER
FT                   VDVNIFSCSNRGCGSNIAKPSEEYFYKDAHVYIEYVKTKNPKHLFIFGSSMGAAVAIDT
FT                   ALKQHDHISGLIVQNAFTSLKELSRYSHPFLNYFLFDYDMIIRSKMDNETKIKNITVPT
FT                   LFTLSEMDEKVPTSHTRTLFQLSASTNKQLYLSKGGTHPNILKNDDGSYHKAMKKFIVT
FT                   AISIREKNIQKAVERNPNTPN"
     MRIIKYIFFA FIILALFVCA LNTYIYLKQD SFVFSNEFPT VEEKNQTLGE NYEIVTLTTK        60
     DNHKFTCWYI KTKDSENKPI MLYFQGNGGY LEKYMNLFNL IIERVDVNIF SCSNRGCGSN       120
     IAKPSEEYFY KDAHVYIEYV KTKNPKHLFI FGSSMGAAVA IDTALKQHDH ISGLIVQNAF       180
     TSLKELSRYS HPFLNYFLFD YDMIIRSKMD NETKIKNITV PTLFTLSEMD EKVPTSHTRT       240
     LFQLSASTNK QLYLSKGGTH PNILKNDDGS YHKAMKKFIV TAISIREKNI QKAVERNPNT       300
     PN                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page