(data stored in ACNUC9543 zone)

EMBL: AL844507.PE184

AL844507.PE184       Location/Qualifiers
FT   CDS             complement(855654..856742)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0818800"
FT                   /product="U3 small nucleolar ribonucleoprotein protein
FT                   IMP4, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0818800"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0055:mRNA"
FT                   /db_xref="GOA:Q8IB23"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB23"
FT                   /protein_id="CAD51186.1"
FT                   /translation="MLRRNIRLRKEYLYLKKVEDEKKKYAEKIKSIKESYDKNKKIRGD
FT                   LKDEESELRKNMNLYDEKSFDRKVDDEYFFCGLENPRVLITTSRNPSSTLENFAKELKL
FT                   IIPNSEKINRGSYFIKDILNFARKNNITDVIILHEYKGIPRNLIICHLPFGPTLFCTIK
FT                   DCKMRCEFNEKIDNISLCTPHLIFHNFHSDLGKRIMNIFKYLFPPVTMRTNKRKMPKHN
FT                   SQIVKDNKLNKNININTNNNDTNQMDQMDQMNKIKFVTHTTQDDEDNNDHLQIYFKNNE
FT                   YLNLQKYENNRVIVFFNKNDIIYFRHYNWEKNQTNEIVLKEIGPRFSFVVYKINKETLD
FT                   SLNEDYEYIYRPFMNSRKALLT"
     MLRRNIRLRK EYLYLKKVED EKKKYAEKIK SIKESYDKNK KIRGDLKDEE SELRKNMNLY        60
     DEKSFDRKVD DEYFFCGLEN PRVLITTSRN PSSTLENFAK ELKLIIPNSE KINRGSYFIK       120
     DILNFARKNN ITDVIILHEY KGIPRNLIIC HLPFGPTLFC TIKDCKMRCE FNEKIDNISL       180
     CTPHLIFHNF HSDLGKRIMN IFKYLFPPVT MRTNKRKMPK HNSQIVKDNK LNKNININTN       240
     NNDTNQMDQM DQMNKIKFVT HTTQDDEDNN DHLQIYFKNN EYLNLQKYEN NRVIVFFNKN       300
     DIIYFRHYNW EKNQTNEIVL KEIGPRFSFV VYKINKETLD SLNEDYEYIY RPFMNSRKAL       360
     LT                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page