(data stored in ACNUC9543 zone)

EMBL: AL844507.PE185

AL844507.PE185       Location/Qualifiers
FT   CDS             860384..862417
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0818900"
FT                   /product="heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0818900"
FT                   /db_xref="GOA:Q8IB24"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB24"
FT                   /protein_id="CAD51185.1"
FT                   /translation="MASAKGSKPNLPESNIAIGIDLGTTYSCVGVWRNENVDIIANDQG
FT                   NRTTPSYVAFTDTERLIGDAAKNQVARNPENTVFDAKRLIGRKFTESSVQSDMKHWPFT
FT                   VKSGVDEKPMIEVTYQGEKKLFHPEEISSMVLQKMKENAEAFLGKSIKNAVITVPAYFN
FT                   DSQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLHKKGKGEKNILIFDLGGGTFDVSLL
FT                   TIEDGIFEVKATAGDTHLGGEDFDNRLVNFCVEDFKRKNRGKDLSKNSRALRRLRTQCE
FT                   RAKRTLSSSTQATIEIDSLFEGIDYSVTVSRARFEELCIDYFRDTLIPVEKVLKDAMMD
FT                   KKSVHEVVLVGGSTRIPKIQTLIKEFFNGKEACRSINPDEAVAYGAAVQAAILSGDQSN
FT                   AVQDLLLLDVCSLSLGLETAGGVMTKLIERNTTIPAKKSQIFTTYADNQPGVLIQVYEG
FT                   ERALTKDNNLLGKFHLDGIPPAPRKVPQIEVTFDIDANGILNVTAVEKSTGKQNHITIT
FT                   NDKGRLSQDEIDRMVNDAEKYKAEDEENRKRIEARNSLENYCYGVKSSLEDQKIKEKLQ
FT                   PAEIETCMKTITTILEWLEKNQLAGKDEYEAKQKEAESVCAPIMSKIYQDAAGAAGGMP
FT                   GGMPGGMPGGMPGGMNFPGGMPGAGMPGNAPAGSGPTVEEVD"
     MASAKGSKPN LPESNIAIGI DLGTTYSCVG VWRNENVDII ANDQGNRTTP SYVAFTDTER        60
     LIGDAAKNQV ARNPENTVFD AKRLIGRKFT ESSVQSDMKH WPFTVKSGVD EKPMIEVTYQ       120
     GEKKLFHPEE ISSMVLQKMK ENAEAFLGKS IKNAVITVPA YFNDSQRQAT KDAGTIAGLN       180
     VMRIINEPTA AAIAYGLHKK GKGEKNILIF DLGGGTFDVS LLTIEDGIFE VKATAGDTHL       240
     GGEDFDNRLV NFCVEDFKRK NRGKDLSKNS RALRRLRTQC ERAKRTLSSS TQATIEIDSL       300
     FEGIDYSVTV SRARFEELCI DYFRDTLIPV EKVLKDAMMD KKSVHEVVLV GGSTRIPKIQ       360
     TLIKEFFNGK EACRSINPDE AVAYGAAVQA AILSGDQSNA VQDLLLLDVC SLSLGLETAG       420
     GVMTKLIERN TTIPAKKSQI FTTYADNQPG VLIQVYEGER ALTKDNNLLG KFHLDGIPPA       480
     PRKVPQIEVT FDIDANGILN VTAVEKSTGK QNHITITNDK GRLSQDEIDR MVNDAEKYKA       540
     EDEENRKRIE ARNSLENYCY GVKSSLEDQK IKEKLQPAEI ETCMKTITTI LEWLEKNQLA       600
     GKDEYEAKQK EAESVCAPIM SKIYQDAAGA AGGMPGGMPG GMPGGMPGGM NFPGGMPGAG       660
     MPGNAPAGSG PTVEEVD                                                      677
//

If you have problems or comments...

PBIL Back to PBIL home page