(data stored in SCRATCH zone)

EMBL: AL844507.PE186

AL844507.PE186       Location/Qualifiers
FT   CDS             complement(join(863505..864138,864312..866588,
FT                   866707..866794,866925..867532,867803..868137))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0819000"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0819000"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.64:mRNA"
FT                   /db_xref="GOA:Q8IB25"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR027075"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB25"
FT                   /protein_id="CAD51184.1"
FT                   /translation="MLIEIVPLYSNSFYSTLLIIKDFNVLKENERISLKDNLNEQNENQ
FT                   SSDKNVSISSVENINVENYNCEELYKYDYVNNKRDFYNDRKDNNIYILMNCGWDDKFCL
FT                   EDIKNVIRVCEVIDLIIITNHSLNYIGSLPVVFMELLKRKKKVPIICHEYIKSYSKYIL
FT                   LSYLKCNYNCEYFKNFKENEYIELINNLYENIIILEYMEHYVFKKVICKKTNIEYILPL
FT                   YLINNGDNIGSSAVILKLFNNKILYSINCNLEDYSFIEKSHVIKESNIFTYISNFHYSN
FT                   KNSTKMMDMKNILNTINKTIKKMGCVLLPVDIDSIFIDLLFHINALLEVCSQRYMLLFL
FT                   CPYGENFIRLLFTSLTYMNVHIKNNFHKNRINLFKIKNLICLKNYNDFKKYEDAYYILF
FT                   SFPSTLNNESVKRILSTFLKKEENVILFTKEQTGQENMSSNLWKHVSCNEQNKEKEKTS
FT                   HFNFSYVQNIKYDDKMLYDIYLKEKENIQNEILQKKGEEKIKKKIKRSVKKNKPMNFIF
FT                   ESHEEMLYLKKENNFVDKKKEIKCKRDFWEDNKDKVVKSEKNDDDKDDDKDDDKDDDKD
FT                   DDKDDDKDDNNDDNNDDNNDDNNDDNNDDNNDDNYNDDDEIYDESSNSSNSNDYEDENY
FT                   FLKGNKKKKYLYRINTFNEGDTSDDGDNQINDINKLSDNNESEDDDFNHLIKSKDDNRK
FT                   KKNKQKIYRDFPYQNVNNHNDDANSSESIIDDEEEYYKKEVVEDVKDGSLKNQNKKKVR
FT                   IKMEPMNDDNDNNYVEEEEYKIAGVHEKKLRSNIKKELYFYDNMEQNYNQNEDDYNDDD
FT                   YNDDNYNDDDYNDDDDNDDNDDDNDDDNNNEEEKHEYVKKISGDKNKKRNKNRSKTNYH
FT                   YDNYYNMKENLDESENMSDYYNINKGKHILNKGSTLNNTFDTDYKHQNNRHMINKKMAW
FT                   KQKLFVYLKKIPTQEKQQHVSIPIECLIELYNLENYINQNTLKTIIQFMKPKHFVLLPT
FT                   YNSYYSFHLEMLLHSSISTYDYTKIYSFYIPNFYYTDNHNEVFFKRYFSLNNKSIDSVH
FT                   IPLNMNYENIYIRSIYNLISSKNCQDDKFQIYKIKATISDVSVKNKKDVYENYRRRKRF
FT                   INEHSTFWSEYNDVNYILKLGDDEKYDEEKEDKEENIPSEEKEKENEKSNERRFLNFYI
FT                   DDDKENEEDESDEDSIDFSDSCLSSDRQECILSKDMNEENNNKIEGNLYIGDVNMQNLC
FT                   TNIHSVFNRSLNFVDENQIIINGNTCVKKEVQTKVQNQNQENYEDKENFKKQDHNSNSN
FT                   FIWRIESSLDPTFYFVRNILKDMYNNVSI"
     MLIEIVPLYS NSFYSTLLII KDFNVLKENE RISLKDNLNE QNENQSSDKN VSISSVENIN        60
     VENYNCEELY KYDYVNNKRD FYNDRKDNNI YILMNCGWDD KFCLEDIKNV IRVCEVIDLI       120
     IITNHSLNYI GSLPVVFMEL LKRKKKVPII CHEYIKSYSK YILLSYLKCN YNCEYFKNFK       180
     ENEYIELINN LYENIIILEY MEHYVFKKVI CKKTNIEYIL PLYLINNGDN IGSSAVILKL       240
     FNNKILYSIN CNLEDYSFIE KSHVIKESNI FTYISNFHYS NKNSTKMMDM KNILNTINKT       300
     IKKMGCVLLP VDIDSIFIDL LFHINALLEV CSQRYMLLFL CPYGENFIRL LFTSLTYMNV       360
     HIKNNFHKNR INLFKIKNLI CLKNYNDFKK YEDAYYILFS FPSTLNNESV KRILSTFLKK       420
     EENVILFTKE QTGQENMSSN LWKHVSCNEQ NKEKEKTSHF NFSYVQNIKY DDKMLYDIYL       480
     KEKENIQNEI LQKKGEEKIK KKIKRSVKKN KPMNFIFESH EEMLYLKKEN NFVDKKKEIK       540
     CKRDFWEDNK DKVVKSEKND DDKDDDKDDD KDDDKDDDKD DDKDDNNDDN NDDNNDDNND       600
     DNNDDNNDDN YNDDDEIYDE SSNSSNSNDY EDENYFLKGN KKKKYLYRIN TFNEGDTSDD       660
     GDNQINDINK LSDNNESEDD DFNHLIKSKD DNRKKKNKQK IYRDFPYQNV NNHNDDANSS       720
     ESIIDDEEEY YKKEVVEDVK DGSLKNQNKK KVRIKMEPMN DDNDNNYVEE EEYKIAGVHE       780
     KKLRSNIKKE LYFYDNMEQN YNQNEDDYND DDYNDDNYND DDYNDDDDND DNDDDNDDDN       840
     NNEEEKHEYV KKISGDKNKK RNKNRSKTNY HYDNYYNMKE NLDESENMSD YYNINKGKHI       900
     LNKGSTLNNT FDTDYKHQNN RHMINKKMAW KQKLFVYLKK IPTQEKQQHV SIPIECLIEL       960
     YNLENYINQN TLKTIIQFMK PKHFVLLPTY NSYYSFHLEM LLHSSISTYD YTKIYSFYIP      1020
     NFYYTDNHNE VFFKRYFSLN NKSIDSVHIP LNMNYENIYI RSIYNLISSK NCQDDKFQIY      1080
     KIKATISDVS VKNKKDVYEN YRRRKRFINE HSTFWSEYND VNYILKLGDD EKYDEEKEDK      1140
     EENIPSEEKE KENEKSNERR FLNFYIDDDK ENEEDESDED SIDFSDSCLS SDRQECILSK      1200
     DMNEENNNKI EGNLYIGDVN MQNLCTNIHS VFNRSLNFVD ENQIIINGNT CVKKEVQTKV      1260
     QNQNQENYED KENFKKQDHN SNSNFIWRIE SSLDPTFYFV RNILKDMYNN VSI             1313
//

If you have problems or comments...

PBIL Back to PBIL home page