(data stored in SCRATCH zone)

EMBL: AL844507.PE187

AL844507.PE187       Location/Qualifiers
FT   CDS             join(869562..870420,870546..870574)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0819100"
FT                   /product="BRIX domain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0819100"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0053:mRNA"
FT                   /db_xref="GOA:Q8IB26"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB26"
FT                   /protein_id="CAD51183.2"
FT                   /translation="MVTKIKGKFKKGASNNKEAGIRNKKNKKKNNNRKSDINENEESLI
FT                   KKTNIMVIKKKGMNSEIKALSRDLVDLFNPYCAVFYIRKLKNLQELNKKLKELSYKYTV
FT                   CFYIQNNKLLYSITSNYTKLSLTFSVQSYTTSTLIKSLYLKNVYCNFNKLKPLLILKNF
FT                   NNTSNTEMSNYLIITQNILKNLYPSVNLNEDFMNKPRRVLLYCYNDNDQTIYFRQYATN
FT                   LKKISFKKILKEAYNEDMSGYNDVFNYLSSKLDGKHFNTDTISQMLEIGPRVSYKIFKI
FT                   TDQDKVIYSVTDKK"
     MVTKIKGKFK KGASNNKEAG IRNKKNKKKN NNRKSDINEN EESLIKKTNI MVIKKKGMNS        60
     EIKALSRDLV DLFNPYCAVF YIRKLKNLQE LNKKLKELSY KYTVCFYIQN NKLLYSITSN       120
     YTKLSLTFSV QSYTTSTLIK SLYLKNVYCN FNKLKPLLIL KNFNNTSNTE MSNYLIITQN       180
     ILKNLYPSVN LNEDFMNKPR RVLLYCYNDN DQTIYFRQYA TNLKKISFKK ILKEAYNEDM       240
     SGYNDVFNYL SSKLDGKHFN TDTISQMLEI GPRVSYKIFK ITDQDKVIYS VTDKK            295
//

If you have problems or comments...

PBIL Back to PBIL home page