(data stored in ACNUC9543 zone)

EMBL: AL844507.PE189

AL844507.PE189       Location/Qualifiers
FT   CDS             874367..877498
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0819300"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0819300"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0051:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4V9"
FT                   /protein_id="CAX64137.2"
FT                   /translation="MNIVVTNYGILRKNFIRTYLANKINTIKGTYKNICIYHVDIKRYC
FT                   HYKSRSKIKCKNNGVMNKDMNFICDELKEKYIDNNHMNNVHNNNSYNNFNTFYENGNNK
FT                   DNFNVSKKCVGKKVIRDTFINKIKEGTLSLLNLEIEELNYEELLKYKNIKKVVVMKNKL
FT                   TILKYFNSYLLKNNKGKYYILKVLMFCIVKDIHKYKNNELIYILYIYKYHNYLNPFLIL
FT                   HIIDKLCCDNYIYNMNIKEFVFLLDILNVPLVMTNKFIQNIMDYININQNKIKYCKYYF
FT                   DIAYFLAKNNLYNKYIFDTIAQYYTSHSYNFELSILYMFNNEHKNINRNNNAFPIKGSY
FT                   NINNNIVDINICEELINNDDYLNVKQRNMLKKVESDNGCYDNTYDNNNIINFKREIHKH
FT                   LYILSKYGYKNIQIYNNMFKIIIFSCNHFKPFEVSSIFKSLKNINYFNIVLLEKLTSTL
FT                   KKNISQYKTSLLLDCLNTLSYFNYKDDNIITTILINLPRNISTYTSNQFLKLVYFMDNF
FT                   IPFSIYFNIFLNKQICIFSSSFGLCHLISLLKIFTHQNLISNPILYLLRIKISKYNKSL
FT                   TYNDIKSKHINEKPDEIFPSINYTGNIKISYKDIYSIFYHMHLMRVQYMDLAIKCIECI
FT                   FFMEKNFKNIFSEDIEYITNSCCYFLLLNDNYDDPFLRKFINVHIENFFSFVASNFVKN
FT                   ESLEKKNECINGNMEMEKINDNNNNNKKKKKYKTYNIKMDDIKMDDIKMDDIKMGDIHF
FT                   AHYEKNNGTIHFNNKINYNEQIIDIQNNNNDKKNLYLAFNKKKNVYAIIILTLINELVY
FT                   QNSIKKISNIIHNFNLEYIKNNIYVFLQHFNNEKNEKEKCDTIYILEKLFPLLYFPKIN
FT                   NVHLKNISRNNFNISTFNLTYVQNGYNNYLKSEHIKKEIISNQYILNEIYKILRSLKQK
FT                   NYIFKLINKSHTKSFFLYNHYIYVKNIRNGDKIAILFASKNYYYNTIDDANLGLTSKMG
FT                   KKIFEKKKFTKEAITQIEYFKIYFNKVYLVEFYTWENMINIQEKKDYLVNLLNI"
     MNIVVTNYGI LRKNFIRTYL ANKINTIKGT YKNICIYHVD IKRYCHYKSR SKIKCKNNGV        60
     MNKDMNFICD ELKEKYIDNN HMNNVHNNNS YNNFNTFYEN GNNKDNFNVS KKCVGKKVIR       120
     DTFINKIKEG TLSLLNLEIE ELNYEELLKY KNIKKVVVMK NKLTILKYFN SYLLKNNKGK       180
     YYILKVLMFC IVKDIHKYKN NELIYILYIY KYHNYLNPFL ILHIIDKLCC DNYIYNMNIK       240
     EFVFLLDILN VPLVMTNKFI QNIMDYININ QNKIKYCKYY FDIAYFLAKN NLYNKYIFDT       300
     IAQYYTSHSY NFELSILYMF NNEHKNINRN NNAFPIKGSY NINNNIVDIN ICEELINNDD       360
     YLNVKQRNML KKVESDNGCY DNTYDNNNII NFKREIHKHL YILSKYGYKN IQIYNNMFKI       420
     IIFSCNHFKP FEVSSIFKSL KNINYFNIVL LEKLTSTLKK NISQYKTSLL LDCLNTLSYF       480
     NYKDDNIITT ILINLPRNIS TYTSNQFLKL VYFMDNFIPF SIYFNIFLNK QICIFSSSFG       540
     LCHLISLLKI FTHQNLISNP ILYLLRIKIS KYNKSLTYND IKSKHINEKP DEIFPSINYT       600
     GNIKISYKDI YSIFYHMHLM RVQYMDLAIK CIECIFFMEK NFKNIFSEDI EYITNSCCYF       660
     LLLNDNYDDP FLRKFINVHI ENFFSFVASN FVKNESLEKK NECINGNMEM EKINDNNNNN       720
     KKKKKYKTYN IKMDDIKMDD IKMDDIKMGD IHFAHYEKNN GTIHFNNKIN YNEQIIDIQN       780
     NNNDKKNLYL AFNKKKNVYA IIILTLINEL VYQNSIKKIS NIIHNFNLEY IKNNIYVFLQ       840
     HFNNEKNEKE KCDTIYILEK LFPLLYFPKI NNVHLKNISR NNFNISTFNL TYVQNGYNNY       900
     LKSEHIKKEI ISNQYILNEI YKILRSLKQK NYIFKLINKS HTKSFFLYNH YIYVKNIRNG       960
     DKIAILFASK NYYYNTIDDA NLGLTSKMGK KIFEKKKFTK EAITQIEYFK IYFNKVYLVE      1020
     FYTWENMINI QEKKDYLVNL LNI                                              1043
//

If you have problems or comments...

PBIL Back to PBIL home page