(data stored in ACNUC9543 zone)

EMBL: AL844507.PE190

AL844507.PE190       Location/Qualifiers
FT   CDS             878495..880459
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0819400"
FT                   /product="perforin-like protein 4"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0819400"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0050:mRNA"
FT                   /db_xref="GOA:Q8IB29"
FT                   /db_xref="InterPro:IPR020864"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB29"
FT                   /protein_id="CAD51180.1"
FT                   /translation="MMIFSNYLFNILIVCYLFIYIGSFSICHDIKTDEKTNEIFSKYLG
FT                   KGYDILFGYPLPNNELIDDPGFKEVIIDTQLSIDNISNYICKKEEYVDVIEDINDIGYL
FT                   GMQKINIDDLDNRIKPFSASMPYKSYFADLEIKKKKYALAQNMCVLNYATYDLKESGNN
FT                   INKDFVLDIEKLPILTKNQMKLCTKVLYMNNNLHCSEGIKSWMKFFEKYGTHVVLSAHF
FT                   GGMSFNTMEITKRKIEEIKIYKYKYSLWNNPYLNIFKSGSLFQDLSINVDGHKENKKNN
FT                   SNNNINIDEKKKNDAYIKNDVLIEQYRDNINLEIRGGNNFDEKWRNLTYLVWKNSIYSN
FT                   IVPIHLDLYSLNTFMPIEKKESYDMALLFYNNLYGIDNENFYLSQDITDVLSEGKQITG
FT                   SNKGSLILSCPVGYIKSTGLIFVYDSSEKLKTNKSKDPKIKIYPCTNKGQYDIACSYIT
FT                   KKKNIITFGWIYCVKHNFIKFETLYQNNDNIISKDGKTFMSLTCTEGNTIAFGFKMKLK
FT                   KLEKLEKLKIKPCTIGDDQCTINNIKRNSDYLLWGFCVPSSFRSLSSLQLTYIHDDTIQ
FT                   NDIRGACSDIYINKYDNIFLGFTFSFDNKFEQVKTEPCESQSKYCFHIIPKKKKKMYYV
FT                   GMFLLCRFDGNTNRKFTYK"
     MMIFSNYLFN ILIVCYLFIY IGSFSICHDI KTDEKTNEIF SKYLGKGYDI LFGYPLPNNE        60
     LIDDPGFKEV IIDTQLSIDN ISNYICKKEE YVDVIEDIND IGYLGMQKIN IDDLDNRIKP       120
     FSASMPYKSY FADLEIKKKK YALAQNMCVL NYATYDLKES GNNINKDFVL DIEKLPILTK       180
     NQMKLCTKVL YMNNNLHCSE GIKSWMKFFE KYGTHVVLSA HFGGMSFNTM EITKRKIEEI       240
     KIYKYKYSLW NNPYLNIFKS GSLFQDLSIN VDGHKENKKN NSNNNINIDE KKKNDAYIKN       300
     DVLIEQYRDN INLEIRGGNN FDEKWRNLTY LVWKNSIYSN IVPIHLDLYS LNTFMPIEKK       360
     ESYDMALLFY NNLYGIDNEN FYLSQDITDV LSEGKQITGS NKGSLILSCP VGYIKSTGLI       420
     FVYDSSEKLK TNKSKDPKIK IYPCTNKGQY DIACSYITKK KNIITFGWIY CVKHNFIKFE       480
     TLYQNNDNII SKDGKTFMSL TCTEGNTIAF GFKMKLKKLE KLEKLKIKPC TIGDDQCTIN       540
     NIKRNSDYLL WGFCVPSSFR SLSSLQLTYI HDDTIQNDIR GACSDIYINK YDNIFLGFTF       600
     SFDNKFEQVK TEPCESQSKY CFHIIPKKKK KMYYVGMFLL CRFDGNTNRK FTYK             654
//

If you have problems or comments...

PBIL Back to PBIL home page