(data stored in SCRATCH zone)

EMBL: AL844507.PE191

AL844507.PE191       Location/Qualifiers
FT   CDS             join(881590..881685,881814..881873,882002..882058,
FT                   882161..882214,882323..882376,882561..882619,
FT                   882762..882879,883026..883247,883343..883409,
FT                   883557..883676,883930..884023,884136..884190,
FT                   884286..884390)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0819500"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0819500"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.63:mRNA"
FT                   /db_xref="GOA:C0H4W0"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4W0"
FT                   /protein_id="CAX64138.1"
FT                   /translation="MYVLFNDHLKEEGEQNVKLQICNGKNNSSSENENTLSSKYFRKEN
FT                   RRFKQNINILDKHIILADNFGDVPEENFELPDNKQNELEILRKRKNIEPTGIVIACCLG
FT                   TDFRFSALIKDFKTHNVNSDLIKIKKVYSEVIFCSAFEQKKIFFLFRFGCIVLWDFNIK
FT                   EKEILFMYLKDYLSEAHTENNNELDSMFYIMNVQNELSDNKSVKAADSPSFKIKNDIIY
FT                   IYTKDIFEKLSYSYAFAQSVKLSYFENVVDVTIEKTKSIPECLARTGKIQLKKNDISKK
FT                   IGELFVNRFYINMNTDMLDTPEIFWDHDDFTDTYEYFGKYLDISKRVEILNHRLDIIKD
FT                   LYDMLQNELTIQHGYKLEWIVIYLICIEVLIDIVWTIIIKGVFKWG"
     MYVLFNDHLK EEGEQNVKLQ ICNGKNNSSS ENENTLSSKY FRKENRRFKQ NINILDKHII        60
     LADNFGDVPE ENFELPDNKQ NELEILRKRK NIEPTGIVIA CCLGTDFRFS ALIKDFKTHN       120
     VNSDLIKIKK VYSEVIFCSA FEQKKIFFLF RFGCIVLWDF NIKEKEILFM YLKDYLSEAH       180
     TENNNELDSM FYIMNVQNEL SDNKSVKAAD SPSFKIKNDI IYIYTKDIFE KLSYSYAFAQ       240
     SVKLSYFENV VDVTIEKTKS IPECLARTGK IQLKKNDISK KIGELFVNRF YINMNTDMLD       300
     TPEIFWDHDD FTDTYEYFGK YLDISKRVEI LNHRLDIIKD LYDMLQNELT IQHGYKLEWI       360
     VIYLICIEVL IDIVWTIIIK GVFKWG                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page