(data stored in SCRATCH zone)

EMBL: AL844507.PE193

AL844507.PE193       Location/Qualifiers
FT   CDS             complement(888126..890471)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0819700"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0819700"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.61:mRNA"
FT                   /db_xref="GOA:C0H4W1"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4W1"
FT                   /protein_id="CAX64139.1"
FT                   /translation="MKNFCLTKGKVKNVINYAILLCIYIIIWILLTLYCLFNKLKSYII
FT                   SLQLICKYIIIQIVKCNNVNDLNLNNLKNKSNKNFQFLKNKIYNIFYNCLSRKNEKHDD
FT                   IFKIYKNINKVPKHIYIVFKISDLIILNSEKLINHIVNILIYLYEFKIEHVTIYVSDHF
FT                   FDYIFYYDLFKYLYKKNFYMKCVIKENNISNNNNNFISSNDKCNKKNYFSCNYNNHIYD
FT                   TNKSFQCYHHTDEFVITKFSLPQNIPPQENSSPELFYRKRKNKEKMNSNKNKKGNYKDD
FT                   HMNSYKDDHMNSYKDDHMNSYKDDHMNSYKDDHMNSYKDDHMNSYKDDHMNSYKDDHMN
FT                   SYKDDHMNSYKDDHMNSYKDDHMNSYKDDHMNSYKDDHMNSYKDDHMNSYKDDHMNSYK
FT                   DDHMNNYKDDHMNNYKDDHMNNYKDDHMNNYKDDHMNNYKDNHMNSYKHNHMNNYHSTH
FT                   FSYDKFSLHLKFLNKDKSHKHLIKIAKEKGNMLSEGVLINDMLNFSYTNIESVIEKIYQ
FT                   LDKNYNNKYTDNIKNIKKTGNILFYVFYFLQQTKHIFLLKMNCLYYMLSKNILLKVLSK
FT                   DNLRNYSYNNIYRNVYYIWNILKSPFSFHSKYIEKEINNKEKVIAKTNESKNITISIIH
FT                   KLFNNVITQDEKCIKNIKELINKNIPMYVKPIYQDLFNHNVHTLFNPTSVDIVISLRLS
FT                   LSDYLIEIFHLFYHKKYNIKKLNPFHFFMQYISSFLFLYKVVHPFEQNGIQPWVLSNSE
FT                   LYEFYGYHINSLKKSILYYNRSTQRCGH"
     MKNFCLTKGK VKNVINYAIL LCIYIIIWIL LTLYCLFNKL KSYIISLQLI CKYIIIQIVK        60
     CNNVNDLNLN NLKNKSNKNF QFLKNKIYNI FYNCLSRKNE KHDDIFKIYK NINKVPKHIY       120
     IVFKISDLII LNSEKLINHI VNILIYLYEF KIEHVTIYVS DHFFDYIFYY DLFKYLYKKN       180
     FYMKCVIKEN NISNNNNNFI SSNDKCNKKN YFSCNYNNHI YDTNKSFQCY HHTDEFVITK       240
     FSLPQNIPPQ ENSSPELFYR KRKNKEKMNS NKNKKGNYKD DHMNSYKDDH MNSYKDDHMN       300
     SYKDDHMNSY KDDHMNSYKD DHMNSYKDDH MNSYKDDHMN SYKDDHMNSY KDDHMNSYKD       360
     DHMNSYKDDH MNSYKDDHMN SYKDDHMNSY KDDHMNSYKD DHMNNYKDDH MNNYKDDHMN       420
     NYKDDHMNNY KDDHMNNYKD NHMNSYKHNH MNNYHSTHFS YDKFSLHLKF LNKDKSHKHL       480
     IKIAKEKGNM LSEGVLINDM LNFSYTNIES VIEKIYQLDK NYNNKYTDNI KNIKKTGNIL       540
     FYVFYFLQQT KHIFLLKMNC LYYMLSKNIL LKVLSKDNLR NYSYNNIYRN VYYIWNILKS       600
     PFSFHSKYIE KEINNKEKVI AKTNESKNIT ISIIHKLFNN VITQDEKCIK NIKELINKNI       660
     PMYVKPIYQD LFNHNVHTLF NPTSVDIVIS LRLSLSDYLI EIFHLFYHKK YNIKKLNPFH       720
     FFMQYISSFL FLYKVVHPFE QNGIQPWVLS NSELYEFYGY HINSLKKSIL YYNRSTQRCG       780
     H                                                                       781
//

If you have problems or comments...

PBIL Back to PBIL home page