(data stored in ACNUC9543 zone)

EMBL: AL844507.PE194

AL844507.PE194       Location/Qualifiers
FT   CDS             complement(join(891658..891798,892060..892478,
FT                   892604..893711,894053..895249,895448..895613,
FT                   895838..895964,896116..896250,896352..896429,
FT                   896548..896638,896781..896848,896947..896992,
FT                   897101..897172,897286..897365,897455..897757,
FT                   898006..898098,898292..898346,898455..898502))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0819800"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0819800"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.60:mRNA"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR040163"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB33"
FT                   /protein_id="CAD51176.1"
FT                   /translation="MEYKEKPEGPFFVSFYVTNFNSSDQSFSYKINIVDFYDNLYESNI
FT                   INQNNFKQINFSNNYIQLNEEIFVKTNISDDNNFVLIGYENIKVFSFLHEQLIISKNII
FT                   ITYKYEDQKENVVNKNIDNEKNKKTKDNEKEGKNKKKKEKNKNNAKNEMEILENSIKKD
FT                   IDINFNITLNINSLVGHYCDRLNYNIMNVKIDGIYNISSSIEEIVPKRNSLNFHMKLLD
FT                   ISLYNGIPIEDKENKKYNITWNNNNIYKYRNIKEIEYIYKYLFYESFNVNGWIICFNEN
FT                   KKTKDNVTSSIVDTLCATFEVNISDVILNKVVNAKYKLHHIKHLKKDIKNVKQSGNQCL
FT                   DIFTNSYIQLTIQFYKPFLQRKMLESPFAVNTVRPNLKKEIQIENDKKQKEDISNLFNR
FT                   SVMEGIKFVNDEIKQLRKEEQIKIYQRSKEYFSFLNNLKENPKYINLYNNMKDVMIKVT
FT                   YNIINKKIYKHFNISEELCMDPSSDNDDMMDKDKKKKEKSDFISEENINCIFVYLFNFM
FT                   YESSNVIINNYFEKEDNIYKESINDIKKYNNINNLEYYLYNIIIENVHLLKYERNIPFI
FT                   QAIILILYKKINYVYERNIKEKNINDIFIQKGDNHIINIIENYTGYDDNNTLEDNYIYK
FT                   KKKINEKKNVYSNNPENNITSLINHICTRNQSNFNSYLFDYIEHFKDIILHKHVIKEDE
FT                   EIFKRNDHQEDILSVFNMEENKNIKIMFTDIIYMYSNVMLLKNNIINLKYDKERQIRKY
FT                   REENEANKINEENKENEKNEENKEDEKNEENKDEKNEENKEDEKNEENKEDEKNEENNY
FT                   YDDNHNYNFQVNFDYYDTYINSNIVDTSISCLCTYIELTNSENIESLFILCLLYLNIHK
FT                   YKESLKLANYIINILQKRKENEEEIKNKVQDKVQDNVEDNVEDNVEDNVEDKIEEKLKE
FT                   KEEEDHLNINNLYIYSTLHNNHLNICENICIYIKSLCYFFQRNYIYYYINMCILLNENL
FT                   NTLKECIEKNSNLYEEEKEKCFDSRKCNNKESKKKEKKDIEKDHKEKKKGSKKKIKDEN
FT                   NEMKDIQNEEMDMKKNEMDKKKDQMDIKKNEVDIQNEEISIQDEQICNQDEQSQNTYNS
FT                   DKNNNNYNKNVYDNTNISRRKDKSKENSSFKNVKSKSEISPCHTDNYILNYIESSENKI
FT                   PLKDKYMLLFIIYCLKYNIINIVMFIYENRRKLLTDMAINSHLFHHLTIKIFFSIKDYL
FT                   RCTNLIEEKCEHLNNVDILYIYTQCLYKLKSYEKCIGYMEKYLNLCKYNNVRVKIYLQL
FT                   NKIYFSLNRYSESKSMIKNSLQIYKTSYAYLNLAYYYLIKKKNFIYAYKILYKANEINI
FT                   FNTKLWAYFTVVFLHLNMKMQADKSLNNFLKMNMYKKNLIIHMMETYKFYGYEKEEKYL
FT                   LSFLKN"
     MEYKEKPEGP FFVSFYVTNF NSSDQSFSYK INIVDFYDNL YESNIINQNN FKQINFSNNY        60
     IQLNEEIFVK TNISDDNNFV LIGYENIKVF SFLHEQLIIS KNIIITYKYE DQKENVVNKN       120
     IDNEKNKKTK DNEKEGKNKK KKEKNKNNAK NEMEILENSI KKDIDINFNI TLNINSLVGH       180
     YCDRLNYNIM NVKIDGIYNI SSSIEEIVPK RNSLNFHMKL LDISLYNGIP IEDKENKKYN       240
     ITWNNNNIYK YRNIKEIEYI YKYLFYESFN VNGWIICFNE NKKTKDNVTS SIVDTLCATF       300
     EVNISDVILN KVVNAKYKLH HIKHLKKDIK NVKQSGNQCL DIFTNSYIQL TIQFYKPFLQ       360
     RKMLESPFAV NTVRPNLKKE IQIENDKKQK EDISNLFNRS VMEGIKFVND EIKQLRKEEQ       420
     IKIYQRSKEY FSFLNNLKEN PKYINLYNNM KDVMIKVTYN IINKKIYKHF NISEELCMDP       480
     SSDNDDMMDK DKKKKEKSDF ISEENINCIF VYLFNFMYES SNVIINNYFE KEDNIYKESI       540
     NDIKKYNNIN NLEYYLYNII IENVHLLKYE RNIPFIQAII LILYKKINYV YERNIKEKNI       600
     NDIFIQKGDN HIINIIENYT GYDDNNTLED NYIYKKKKIN EKKNVYSNNP ENNITSLINH       660
     ICTRNQSNFN SYLFDYIEHF KDIILHKHVI KEDEEIFKRN DHQEDILSVF NMEENKNIKI       720
     MFTDIIYMYS NVMLLKNNII NLKYDKERQI RKYREENEAN KINEENKENE KNEENKEDEK       780
     NEENKDEKNE ENKEDEKNEE NKEDEKNEEN NYYDDNHNYN FQVNFDYYDT YINSNIVDTS       840
     ISCLCTYIEL TNSENIESLF ILCLLYLNIH KYKESLKLAN YIINILQKRK ENEEEIKNKV       900
     QDKVQDNVED NVEDNVEDNV EDKIEEKLKE KEEEDHLNIN NLYIYSTLHN NHLNICENIC       960
     IYIKSLCYFF QRNYIYYYIN MCILLNENLN TLKECIEKNS NLYEEEKEKC FDSRKCNNKE      1020
     SKKKEKKDIE KDHKEKKKGS KKKIKDENNE MKDIQNEEMD MKKNEMDKKK DQMDIKKNEV      1080
     DIQNEEISIQ DEQICNQDEQ SQNTYNSDKN NNNYNKNVYD NTNISRRKDK SKENSSFKNV      1140
     KSKSEISPCH TDNYILNYIE SSENKIPLKD KYMLLFIIYC LKYNIINIVM FIYENRRKLL      1200
     TDMAINSHLF HHLTIKIFFS IKDYLRCTNL IEEKCEHLNN VDILYIYTQC LYKLKSYEKC      1260
     IGYMEKYLNL CKYNNVRVKI YLQLNKIYFS LNRYSESKSM IKNSLQIYKT SYAYLNLAYY      1320
     YLIKKKNFIY AYKILYKANE INIFNTKLWA YFTVVFLHLN MKMQADKSLN NFLKMNMYKK      1380
     NLIIHMMETY KFYGYEKEEK YLLSFLKN                                         1408
//

If you have problems or comments...

PBIL Back to PBIL home page