(data stored in SCRATCH zone)

EMBL: AL844507.PE197

AL844507.PE197       Location/Qualifiers
FT   CDS             complement(join(909207..909333,909460..909541,
FT                   909713..909877,910011..910716))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0820100"
FT                   /product="RNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0820100"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.59:mRNA"
FT                   /db_xref="GOA:C0H4W4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4W4"
FT                   /protein_id="CAX64142.1"
FT                   /translation="MIFLYFPFVLLLCTFLINFAKCKYIIFNEDKYLRNSSFSYHSNSL
FT                   FKVRKYFHNFILSNNYFSKKKSKQCKSFNHELNKENELKGEEDTFFLFPENILDEDKSY
FT                   LPFDKEKIMASIKKHKKEDDNIKNILKKTKKHCNYLTNKLGRLNKKLREIKKLETVFYA
FT                   NPNILTEEQKVKLSKKDQVKNEIVIINRYRKKYISYKRNLQKNVDDTSPFFYNKKKKKE
FT                   KKKFCTPEEFREILKSNDPKGTIQKIKKIDLNKIPRNVTDFLVFNKVGTKEEVKILFGL
FT                   KAIKINGNTIDDENYILNIKEDEVKVFDQIVHIHEDHYAIRKRFTTKQKQILNKKKKET
FT                   ITEAKKEVKEVEKFFGINI"
     MIFLYFPFVL LLCTFLINFA KCKYIIFNED KYLRNSSFSY HSNSLFKVRK YFHNFILSNN        60
     YFSKKKSKQC KSFNHELNKE NELKGEEDTF FLFPENILDE DKSYLPFDKE KIMASIKKHK       120
     KEDDNIKNIL KKTKKHCNYL TNKLGRLNKK LREIKKLETV FYANPNILTE EQKVKLSKKD       180
     QVKNEIVIIN RYRKKYISYK RNLQKNVDDT SPFFYNKKKK KEKKKFCTPE EFREILKSND       240
     PKGTIQKIKK IDLNKIPRNV TDFLVFNKVG TKEEVKILFG LKAIKINGNT IDDENYILNI       300
     KEDEVKVFDQ IVHIHEDHYA IRKRFTTKQK QILNKKKKET ITEAKKEVKE VEKFFGINI        359
//

If you have problems or comments...

PBIL Back to PBIL home page