(data stored in ACNUC9543 zone)

EMBL: AL844507.PE2

AL844507.PE2         Location/Qualifiers
FT   CDS             complement(join(29700..30878,31636..39033))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0800200"
FT                   /product="erythrocyte membrane protein 1, PfEMP1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0800200"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0141:mRNA"
FT                   /db_xref="GOA:Q8IAK2"
FT                   /db_xref="InterPro:IPR004258"
FT                   /db_xref="InterPro:IPR008602"
FT                   /db_xref="InterPro:IPR029210"
FT                   /db_xref="InterPro:IPR029211"
FT                   /db_xref="InterPro:IPR041480"
FT                   /db_xref="InterPro:IPR042202"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAK2"
FT                   /protein_id="CAD51362.1"
FT                   /translation="MGSQGSKPVDTSDVKNESHNSARNVFENIAEIIYNRVKEDAEKRG
FT                   KSLKGDYKRAKFHQPLLEAAKYVWYAPSNPCNFDFRFDTNAPDKGSYDRDPCHLRDTNR
FT                   FSDKGDAICTNNKINCNNGGCGACAPYRRIQLCDYNLEYINEYNINSTHDLLGNLLVMA
FT                   KREGDSIVNSHGHTGKGIYKSGICTSLARSFADIGDIIRGKDLFLGHNHKKKPLLDNLE
FT                   KIFNRFQKIYEDINNLPIDDIREYWWALNRNDVWEALTCSAPYYADYFKKKSGNTYNFT
FT                   TEGYCGRNEGAPPTNLDYVPQFLRWFDEWAEEFCRIKNIKIGNIKKSCTGESNNKHCSR
FT                   EGYDCNKTNLRLNEIFMDLECPRCADDCKSYETWVENKKKEFNKQKEKYKEEINESKPG
FT                   VNSEHGKYNKAFYDKLRTIYRTNDKFFEILNKGQICENVDEKNKIDFNDLVKTFSRSEY
FT                   CKSCPMLGVTCKGEQCNSLDDITCTNDKGGPNKVTDKNNNTFVIDILLNDNKKKVLSND
FT                   LNDYKECDLFKRLRRQNWNCKYKCNLHVCELNNFNNEIDDERVISIKVFIKRWLESFLK
FT                   DYNKLKENLNPCINNENQLPCIKDCLENCDCVEKWIKKKGEEWKKIKERYLKDYKIEDN
FT                   NSSNSLNKFLQQNQFHSDVVKAIKPFENLRAFEDSSGCTGTVPSGIEECKSNDVIKILL
FT                   SKLKEKIELCKKNDVKKNKSNNCVTLLKPLNDEEDDEEQDDEPPAPKPLPTPNPCVNGG
FT                   DDTSGAQITSVTEIAEGMHMGAQKQMLERSGDKSGKGTENGESVLKGDIKKAKFKNGAS
FT                   PSSLEDVCGITDQHTKDSRRRRRLRRLRLLVLRFRRRLRRGHRDYKGPCTGKDGHKKMF
FT                   QVEKGWENGSKIGTENDVFLPPRREHFCTSNVEHLYRSASGLQGTTASHSLLGDVLLAA
FT                   NKEAGFIKERYKTQKTSEGFKDEATVCRAIKYSFADIADIIKGTDLWKANSGKKNTQDK
FT                   LVKIFQKIKDNLPVNIKGKYNEDEKHLELRKDWWFANRDKVWEAMKCEQNGITCSGPTP
FT                   LDDYIPQRLRWMTEWAEWYCKAQKEAYDKLKVCEKCMDNGKCTQGNGECAKCKTACENY
FT                   KKFINTWQPQWKQMEQKYESLYKEAQENGNSSHKSTTEQDKYMVEFLSQLQKANNGDKT
FT                   GDDKVYSTAAGYVHQEATMNCEKQTQFCKNKNGVKAANDAEDVNYTFKDTPNGYDVVCK
FT                   CKDRPEQQIKKKEVEDACKIAQDIFKGKDENTTVGLCKKKDFGRTPYPDWKCEKNSKLV
FT                   TGNGECMPPRRQKLCLYFLAHKIETPNLNTQEDLRKAFIKCAAAETFFSWYYFKKINDK
FT                   LNKLDEKLKEGEIPPQFLRSMFYTFGDYKDICLDTDISLKTENGDITKAKSNIDRIIPK
FT                   KSAKNPDEERKIWWDGIKEDVWEGMLCGLSHAVSNNDKATVQKTLTTKTIYDYDTVTFD
FT                   GTTKLEDFSKRPQFLRWMTEWGEEFCKKRKEQLENLKDKCPDYTCSFDTKKQECENHCK
FT                   VYEEWLKGWKDQYKKQSEKFTTDKEKPEYKDDPDVASSENAHKYLSKKLKQIFHNGSTT
FT                   EKCDYTCMEYASRQPQTSACSQQQQQQNKSSTQNHFPEAFDYPPKEIGDRCTCPKLPEP
FT                   KYCVDKTAYDIRKESGKKSDNSLKGNGNTYNNNCNNSMREEYANQNGETCKFNETFWSK
FT                   KKPSIEECDINAKERFQIQKYWDCNGKTPDGKNTFCIPPRRKDMCLKQLEEINSADVNN
FT                   SKKLLQKIQDVAKKEGDDIIKKLLPKYPCNEDVICKAMKYSFADLADIVRGIDKYKGPN
FT                   GTNVLEKELKSVFETIYTKWKSENTNNKSKYTDVASFRSAWWDANRKDIWNAMTCNAPY
FT                   DAKIYITKEGGYISPLTFTKNKCGHNDDPPDYDYIPQPFRWLSEWSETYCLAQKDLLET
FT                   MKNCENCMKKNKNADCEQTQYGACRDCKRKCEEYKKFIEIWKKQFETQNKAYQEIYRNA
FT                   TTTNRDNNNIVDENTKNFVKKLQENCRTDRNESLDTADKYLENASVCRRFKFGNKDSRH
FT                   LNYAFHTDPPSYEEHCKCAKDFDPLDECPVDNNECKKYGIGSCPKKNFHKKLEEWTNYV
FT                   LNNKSNKNKSAIVPPRRRQLCLQNLTRNLSRLNKEKSFKEGILISAASEAKMLTEQYRE
FT                   NPAKALQAIKYSFADIGNIIKGDDIIGNVISVQLNKLINGNKKINTSTLWWEANKEKIW
FT                   NAMMCYYTGDEKTATSCPSHGNIDKEDQFLLWFQEWGENFCARQKELYEHVQAECSHVI
FT                   CVNGTGNIDSKCTEACKNYSNFISETKNVYQSLKKQYNDNHNSIKVGGKEVHHYMKEKC
FT                   KDKCECLSEKFNSDNNWEKPYDTFDDTVLKNKCQCKKPDSPILPVEPSVPAETEKEKKK
FT                   DSPLKPHTEPKPAPPKKPEVPPPPPVQPPPANQPFNRDILEKTIPFGIALALGSIAFLF
FT                   IKKKPKSPVDLIRVLDIHKGDYGMPTLKSKNRYIPYASDTYKGKTYIYMEGDSDSGHYY
FT                   EDTTDITSSESEYEEMDINDIYVPDSPKYKTLIEVVLEPSKRDTPSSDAPMNKFTDDEW
FT                   NQLKQDFISGILENEQKDLPKNNISGNTPMNTQPNTLYFNKPEEKPFITSIHDRDLYSG
FT                   EEINYNINMSTNSMDDTSYVSNNVYSGIDLINDTLSGNQHIDIYDEVLKRKENELFGTN
FT                   YKKNTSNNNVAKLTNSDPIMNQLDLLHKWLDRHRDMCEKWKSKEDILHKLNEQWNKDND
FT                   GGNVPIDNRSLNTDVWIEIDMDDPKGKKEFSNMDTILDDIEDDIYYDVNDDENPSVDNI
FT                   PMDHNKVDVPKKVHVEMKILNNTSNGSLEPEFPISDVWNI"
     MGSQGSKPVD TSDVKNESHN SARNVFENIA EIIYNRVKED AEKRGKSLKG DYKRAKFHQP        60
     LLEAAKYVWY APSNPCNFDF RFDTNAPDKG SYDRDPCHLR DTNRFSDKGD AICTNNKINC       120
     NNGGCGACAP YRRIQLCDYN LEYINEYNIN STHDLLGNLL VMAKREGDSI VNSHGHTGKG       180
     IYKSGICTSL ARSFADIGDI IRGKDLFLGH NHKKKPLLDN LEKIFNRFQK IYEDINNLPI       240
     DDIREYWWAL NRNDVWEALT CSAPYYADYF KKKSGNTYNF TTEGYCGRNE GAPPTNLDYV       300
     PQFLRWFDEW AEEFCRIKNI KIGNIKKSCT GESNNKHCSR EGYDCNKTNL RLNEIFMDLE       360
     CPRCADDCKS YETWVENKKK EFNKQKEKYK EEINESKPGV NSEHGKYNKA FYDKLRTIYR       420
     TNDKFFEILN KGQICENVDE KNKIDFNDLV KTFSRSEYCK SCPMLGVTCK GEQCNSLDDI       480
     TCTNDKGGPN KVTDKNNNTF VIDILLNDNK KKVLSNDLND YKECDLFKRL RRQNWNCKYK       540
     CNLHVCELNN FNNEIDDERV ISIKVFIKRW LESFLKDYNK LKENLNPCIN NENQLPCIKD       600
     CLENCDCVEK WIKKKGEEWK KIKERYLKDY KIEDNNSSNS LNKFLQQNQF HSDVVKAIKP       660
     FENLRAFEDS SGCTGTVPSG IEECKSNDVI KILLSKLKEK IELCKKNDVK KNKSNNCVTL       720
     LKPLNDEEDD EEQDDEPPAP KPLPTPNPCV NGGDDTSGAQ ITSVTEIAEG MHMGAQKQML       780
     ERSGDKSGKG TENGESVLKG DIKKAKFKNG ASPSSLEDVC GITDQHTKDS RRRRRLRRLR       840
     LLVLRFRRRL RRGHRDYKGP CTGKDGHKKM FQVEKGWENG SKIGTENDVF LPPRREHFCT       900
     SNVEHLYRSA SGLQGTTASH SLLGDVLLAA NKEAGFIKER YKTQKTSEGF KDEATVCRAI       960
     KYSFADIADI IKGTDLWKAN SGKKNTQDKL VKIFQKIKDN LPVNIKGKYN EDEKHLELRK      1020
     DWWFANRDKV WEAMKCEQNG ITCSGPTPLD DYIPQRLRWM TEWAEWYCKA QKEAYDKLKV      1080
     CEKCMDNGKC TQGNGECAKC KTACENYKKF INTWQPQWKQ MEQKYESLYK EAQENGNSSH      1140
     KSTTEQDKYM VEFLSQLQKA NNGDKTGDDK VYSTAAGYVH QEATMNCEKQ TQFCKNKNGV      1200
     KAANDAEDVN YTFKDTPNGY DVVCKCKDRP EQQIKKKEVE DACKIAQDIF KGKDENTTVG      1260
     LCKKKDFGRT PYPDWKCEKN SKLVTGNGEC MPPRRQKLCL YFLAHKIETP NLNTQEDLRK      1320
     AFIKCAAAET FFSWYYFKKI NDKLNKLDEK LKEGEIPPQF LRSMFYTFGD YKDICLDTDI      1380
     SLKTENGDIT KAKSNIDRII PKKSAKNPDE ERKIWWDGIK EDVWEGMLCG LSHAVSNNDK      1440
     ATVQKTLTTK TIYDYDTVTF DGTTKLEDFS KRPQFLRWMT EWGEEFCKKR KEQLENLKDK      1500
     CPDYTCSFDT KKQECENHCK VYEEWLKGWK DQYKKQSEKF TTDKEKPEYK DDPDVASSEN      1560
     AHKYLSKKLK QIFHNGSTTE KCDYTCMEYA SRQPQTSACS QQQQQQNKSS TQNHFPEAFD      1620
     YPPKEIGDRC TCPKLPEPKY CVDKTAYDIR KESGKKSDNS LKGNGNTYNN NCNNSMREEY      1680
     ANQNGETCKF NETFWSKKKP SIEECDINAK ERFQIQKYWD CNGKTPDGKN TFCIPPRRKD      1740
     MCLKQLEEIN SADVNNSKKL LQKIQDVAKK EGDDIIKKLL PKYPCNEDVI CKAMKYSFAD      1800
     LADIVRGIDK YKGPNGTNVL EKELKSVFET IYTKWKSENT NNKSKYTDVA SFRSAWWDAN      1860
     RKDIWNAMTC NAPYDAKIYI TKEGGYISPL TFTKNKCGHN DDPPDYDYIP QPFRWLSEWS      1920
     ETYCLAQKDL LETMKNCENC MKKNKNADCE QTQYGACRDC KRKCEEYKKF IEIWKKQFET      1980
     QNKAYQEIYR NATTTNRDNN NIVDENTKNF VKKLQENCRT DRNESLDTAD KYLENASVCR      2040
     RFKFGNKDSR HLNYAFHTDP PSYEEHCKCA KDFDPLDECP VDNNECKKYG IGSCPKKNFH      2100
     KKLEEWTNYV LNNKSNKNKS AIVPPRRRQL CLQNLTRNLS RLNKEKSFKE GILISAASEA      2160
     KMLTEQYREN PAKALQAIKY SFADIGNIIK GDDIIGNVIS VQLNKLINGN KKINTSTLWW      2220
     EANKEKIWNA MMCYYTGDEK TATSCPSHGN IDKEDQFLLW FQEWGENFCA RQKELYEHVQ      2280
     AECSHVICVN GTGNIDSKCT EACKNYSNFI SETKNVYQSL KKQYNDNHNS IKVGGKEVHH      2340
     YMKEKCKDKC ECLSEKFNSD NNWEKPYDTF DDTVLKNKCQ CKKPDSPILP VEPSVPAETE      2400
     KEKKKDSPLK PHTEPKPAPP KKPEVPPPPP VQPPPANQPF NRDILEKTIP FGIALALGSI      2460
     AFLFIKKKPK SPVDLIRVLD IHKGDYGMPT LKSKNRYIPY ASDTYKGKTY IYMEGDSDSG      2520
     HYYEDTTDIT SSESEYEEMD INDIYVPDSP KYKTLIEVVL EPSKRDTPSS DAPMNKFTDD      2580
     EWNQLKQDFI SGILENEQKD LPKNNISGNT PMNTQPNTLY FNKPEEKPFI TSIHDRDLYS      2640
     GEEINYNINM STNSMDDTSY VSNNVYSGID LINDTLSGNQ HIDIYDEVLK RKENELFGTN      2700
     YKKNTSNNNV AKLTNSDPIM NQLDLLHKWL DRHRDMCEKW KSKEDILHKL NEQWNKDNDG      2760
     GNVPIDNRSL NTDVWIEIDM DDPKGKKEFS NMDTILDDIE DDIYYDVNDD ENPSVDNIPM      2820
     DHNKVDVPKK VHVEMKILNN TSNGSLEPEF PISDVWNI                              2858
//

If you have problems or comments...

PBIL Back to PBIL home page