(data stored in SCRATCH zone)

EMBL: AL844507.PE20

AL844507.PE20        Location/Qualifiers
FT   CDS             complement(join(151808..151961,152089..159668))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0802100"
FT                   /product="AP2 domain transcription factor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0802100"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.153:mRNA"
FT                   /db_xref="GOA:Q8IAM1"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAM1"
FT                   /protein_id="CAD51342.1"
FT                   /translation="MEDLETNVVVENTIDEDKVLYSFPFKYFHLLVYAFKNYYFNIYLK
FT                   KVHNNNDNNKIKSNLIEDYKKEEFIENVEEIQEAPALALVSSSPSSLSSSSSSSSFNLL
FT                   KSKYNYKKKKKSRYCDINDKLNFVKFNEKRKCTNRSYNNRYYNDYLKNDNFSKYLSSKN
FT                   NKKNSNLKKSSNLFISEEQPEQGQEDFLEYSEQDIIKLIYYFMENFIFKKKKENRQMNG
FT                   KQLGDRTNEYVDMYTKKSYSDKNVKRKKEGKINIKVKNISQMNVINKNVELAILGRDSL
FT                   SLSLPEEVKGENDQVIIKEIDEKGKRDDKIGTVLNDENVKRNLLNGLLVCNEEDNEEVI
FT                   NKEVLLLKENNINDIMKKDVYKTNMSNDNKLNMENIENDINLTSICYKEKNSSEPSDVT
FT                   HINIEYEGKGIPNNGDTIDENIIDDEKENKIIKDEKEYMEIGNNDDIINDCKKNMNKEI
FT                   SMKLGMKGCVEESNNISEAVKEEEKLKILQIIDNYLQKNEMFFNMNDIFYPFTIKNFNL
FT                   CKNKNEKNKMKRNTITERRYLGNKNNNINIYNNNINMYYNNNNISSLNKVQCNMSNSKG
FT                   VYISEESNNNCPSKEYIKNKIYFSKLRMGLNMLLKHEKKSKRGRRTGGASKNYKKELGE
FT                   QKKKDGMDCDMLVRDSSKRVNKSRNKNKLPDNNRNNNNNMKDNLDINMNNNNNNNNNNN
FT                   NNNNNNNNNNNNNNNNNNNNYYVYGGGATNIGNGKNKFANCNLPYDNPKEYHNVINKDK
FT                   NLIRRNILNVVDTSNMSMYNSHNGDNFNILNKNEPSFSSTNTNNVILKSNHNNNNNNNN
FT                   NNNNNNNNNNNNNNNNSYNNMITFVENNEPNDTGNFYNPKSCVPYYDKTNNNIKNVDDN
FT                   YNQKNYNVVSFNNSQVHPPYNHEEEYKNNSSKVCNTYTNNYMHNINNVNYAGSNMNACL
FT                   NENSVKNDEDCKINYINNNNMEENKNIDNVIIRMYNKKSHTQRMNVPTKDLKNEVYNKT
FT                   GHVKTCNVIKSKTISLNNIVLDLSPNEQMTNGMYENEDMYNVRFKSDENYYNTMNMIGY
FT                   MDKINNMNNLNVTKPTRKNNKSNKNAGKDKTKSRDGKNNNDSSNSPQIFEDNHDEYKDD
FT                   DDNNNNNNNNNNNNNNNNNNNNINVNNNGNNNGNKENHHGHKENGDNKKDNDRNNKENC
FT                   GHNNNQDNDYNNTYKDNEGNNMTSFYNNNINTNYLDERENYLCMEQNNIYLQNEKGKNN
FT                   NDAFLGPEQNCIATIGSCNNNNNDNTSNNMKNKLIRNMNFNGNVNVNNYNITDNDKCLY
FT                   NVKNIINNNEKRGNLCYIKNVKNMNNLHNNNILGNNTFERFDDNNTVHMNSYDDQLYNP
FT                   LNEEEEKKKKKRKKKKSPTIINNDGNINNDGNINNDGNINNDGNINNDDNINNDGNINN
FT                   NGNINNDDNINNNGNIIQETQDDFYLTNHINNNHMMHKQNMSQNIIYHNKVDYLNENDS
FT                   NMNLLDEKKIGYQKKTSKKNEGIMNGKKGKRKYQRKDNKNVNDSNVFTGNNSVFNILPS
FT                   LYTKVENEIDVNNNNINNINNNNINNINNNNINNINNNNINNINNNNNNNNSNICTYYN
FT                   YNTYEVIYNDIHNDDKKKKKSDSKRKDRNSKKKINIEQKIENNNNKESFDNNEMNNYNH
FT                   ELERVTYDSINNNGNIHKGDYIKNNVYNNNYHLHDVNTNSVSSLNNKASSFNTIFTNSR
FT                   STFPKSLSFNSDVTNAKDEINVIGLANSISTGNSTGNSTECVKDGNKDLIGYIQKVDEM
FT                   DKAGHMNKVDFINSGNNDYKNKLDIINNKMYDQFNNVNTGRYHSSNICSDKNYRLNNCI
FT                   NKSMDLKYSTNNIIINNMNNNIFPNECNNKYVCGSDDNMFLNKKKRSCFFMLNEKEKCT
FT                   LKRKVTTTTSGNNKSYINNRDNKKIKKTVGTTNMYDDTNGDGNISNISSMVHKDENMVN
FT                   GYTNNKSSYISKNIQENDMFNEEYNQQINQVGNYDNIANNNITSSQHIQGMYDNNIYVK
FT                   GVGYMNNTKDVKCGGMSTYMNDNENGVMNMEMSILYNDRIVNNNNKKNKNKKNNNNNNN
FT                   GGIDHALPSYQNVIHNNDKVDPIKEDSNNRVGVVTNEGNNNIIMNMNEESSLFKIMGND
FT                   ENRQKGILQHIIGNNNNDNNNNNDINDNNNNNNNHNNNNNHNNNNNNNNNNGSYKIINE
FT                   GTLNINDVMKYDGLASSCFPNINNECTRQMTLNKDASNKNYNFNDEEQVSYFDFRNHMK
FT                   SYYYDKMSESYRNNIQDHYKVGDDNMEGGVLKRMKNSKKKKNATINDDNNKSRNKKNKN
FT                   IHNNNNNNNNNNISNYHSGDNNKVNFSFTTPITQNIFNNENVSLHNLHTDIHTMNTNEI
FT                   CNKSSLPFNTDEIRGYEDNNTNIRRTYMDYQEQNCLDDNHIIFKEIKIKKKKGRKPKVS
FT                   LIQEERNVNLKNNQLYDVDNNLKSFVNDDHTYNVNQSMNQSMNQSMNQNINHNINLTIK
FT                   QNIHVDSHDDNLIVNKDLDKNKTSSDNKRKAKVTRKTNDIKLGNEKVETGAYDENGEKV
FT                   SGVWYDTNRRLWRVMYMENDKRKTRGFSPRIYGFNAARDLAVQLKYEMNKKNKK"
     MEDLETNVVV ENTIDEDKVL YSFPFKYFHL LVYAFKNYYF NIYLKKVHNN NDNNKIKSNL        60
     IEDYKKEEFI ENVEEIQEAP ALALVSSSPS SLSSSSSSSS FNLLKSKYNY KKKKKSRYCD       120
     INDKLNFVKF NEKRKCTNRS YNNRYYNDYL KNDNFSKYLS SKNNKKNSNL KKSSNLFISE       180
     EQPEQGQEDF LEYSEQDIIK LIYYFMENFI FKKKKENRQM NGKQLGDRTN EYVDMYTKKS       240
     YSDKNVKRKK EGKINIKVKN ISQMNVINKN VELAILGRDS LSLSLPEEVK GENDQVIIKE       300
     IDEKGKRDDK IGTVLNDENV KRNLLNGLLV CNEEDNEEVI NKEVLLLKEN NINDIMKKDV       360
     YKTNMSNDNK LNMENIENDI NLTSICYKEK NSSEPSDVTH INIEYEGKGI PNNGDTIDEN       420
     IIDDEKENKI IKDEKEYMEI GNNDDIINDC KKNMNKEISM KLGMKGCVEE SNNISEAVKE       480
     EEKLKILQII DNYLQKNEMF FNMNDIFYPF TIKNFNLCKN KNEKNKMKRN TITERRYLGN       540
     KNNNINIYNN NINMYYNNNN ISSLNKVQCN MSNSKGVYIS EESNNNCPSK EYIKNKIYFS       600
     KLRMGLNMLL KHEKKSKRGR RTGGASKNYK KELGEQKKKD GMDCDMLVRD SSKRVNKSRN       660
     KNKLPDNNRN NNNNMKDNLD INMNNNNNNN NNNNNNNNNN NNNNNNNNNN NNNNYYVYGG       720
     GATNIGNGKN KFANCNLPYD NPKEYHNVIN KDKNLIRRNI LNVVDTSNMS MYNSHNGDNF       780
     NILNKNEPSF SSTNTNNVIL KSNHNNNNNN NNNNNNNNNN NNNNNNNNSY NNMITFVENN       840
     EPNDTGNFYN PKSCVPYYDK TNNNIKNVDD NYNQKNYNVV SFNNSQVHPP YNHEEEYKNN       900
     SSKVCNTYTN NYMHNINNVN YAGSNMNACL NENSVKNDED CKINYINNNN MEENKNIDNV       960
     IIRMYNKKSH TQRMNVPTKD LKNEVYNKTG HVKTCNVIKS KTISLNNIVL DLSPNEQMTN      1020
     GMYENEDMYN VRFKSDENYY NTMNMIGYMD KINNMNNLNV TKPTRKNNKS NKNAGKDKTK      1080
     SRDGKNNNDS SNSPQIFEDN HDEYKDDDDN NNNNNNNNNN NNNNNNNNNI NVNNNGNNNG      1140
     NKENHHGHKE NGDNKKDNDR NNKENCGHNN NQDNDYNNTY KDNEGNNMTS FYNNNINTNY      1200
     LDERENYLCM EQNNIYLQNE KGKNNNDAFL GPEQNCIATI GSCNNNNNDN TSNNMKNKLI      1260
     RNMNFNGNVN VNNYNITDND KCLYNVKNII NNNEKRGNLC YIKNVKNMNN LHNNNILGNN      1320
     TFERFDDNNT VHMNSYDDQL YNPLNEEEEK KKKKRKKKKS PTIINNDGNI NNDGNINNDG      1380
     NINNDGNINN DDNINNDGNI NNNGNINNDD NINNNGNIIQ ETQDDFYLTN HINNNHMMHK      1440
     QNMSQNIIYH NKVDYLNEND SNMNLLDEKK IGYQKKTSKK NEGIMNGKKG KRKYQRKDNK      1500
     NVNDSNVFTG NNSVFNILPS LYTKVENEID VNNNNINNIN NNNINNINNN NINNINNNNI      1560
     NNINNNNNNN NSNICTYYNY NTYEVIYNDI HNDDKKKKKS DSKRKDRNSK KKINIEQKIE      1620
     NNNNKESFDN NEMNNYNHEL ERVTYDSINN NGNIHKGDYI KNNVYNNNYH LHDVNTNSVS      1680
     SLNNKASSFN TIFTNSRSTF PKSLSFNSDV TNAKDEINVI GLANSISTGN STGNSTECVK      1740
     DGNKDLIGYI QKVDEMDKAG HMNKVDFINS GNNDYKNKLD IINNKMYDQF NNVNTGRYHS      1800
     SNICSDKNYR LNNCINKSMD LKYSTNNIII NNMNNNIFPN ECNNKYVCGS DDNMFLNKKK      1860
     RSCFFMLNEK EKCTLKRKVT TTTSGNNKSY INNRDNKKIK KTVGTTNMYD DTNGDGNISN      1920
     ISSMVHKDEN MVNGYTNNKS SYISKNIQEN DMFNEEYNQQ INQVGNYDNI ANNNITSSQH      1980
     IQGMYDNNIY VKGVGYMNNT KDVKCGGMST YMNDNENGVM NMEMSILYND RIVNNNNKKN      2040
     KNKKNNNNNN NGGIDHALPS YQNVIHNNDK VDPIKEDSNN RVGVVTNEGN NNIIMNMNEE      2100
     SSLFKIMGND ENRQKGILQH IIGNNNNDNN NNNDINDNNN NNNNHNNNNN HNNNNNNNNN      2160
     NGSYKIINEG TLNINDVMKY DGLASSCFPN INNECTRQMT LNKDASNKNY NFNDEEQVSY      2220
     FDFRNHMKSY YYDKMSESYR NNIQDHYKVG DDNMEGGVLK RMKNSKKKKN ATINDDNNKS      2280
     RNKKNKNIHN NNNNNNNNNI SNYHSGDNNK VNFSFTTPIT QNIFNNENVS LHNLHTDIHT      2340
     MNTNEICNKS SLPFNTDEIR GYEDNNTNIR RTYMDYQEQN CLDDNHIIFK EIKIKKKKGR      2400
     KPKVSLIQEE RNVNLKNNQL YDVDNNLKSF VNDDHTYNVN QSMNQSMNQS MNQNINHNIN      2460
     LTIKQNIHVD SHDDNLIVNK DLDKNKTSSD NKRKAKVTRK TNDIKLGNEK VETGAYDENG      2520
     EKVSGVWYDT NRRLWRVMYM ENDKRKTRGF SPRIYGFNAA RDLAVQLKYE MNKKNKK         2577
//

If you have problems or comments...

PBIL Back to PBIL home page