(data stored in SCRATCH zone)

EMBL: AL844507.PE201

AL844507.PE201       Location/Qualifiers
FT   CDS             925113..927671
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0820500"
FT                   /product="protein transport protein YIF1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0820500"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.57:mRNA"
FT                   /db_xref="GOA:Q8IB40"
FT                   /db_xref="InterPro:IPR005578"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB40"
FT                   /protein_id="CAD51169.1"
FT                   /translation="MSYNNNYVDFNIHDRRKTNNANFKEEENSWSNMSFSKGNNLNNNV
FT                   MKRGGHMDITNNKNFMDININDMNRMNNMNNFYSGHVTDVNNTENDESAHLLNKNVQVD
FT                   NTYVNNLINPNDNVTHPFAKNINNNTSSSNYVSAHPIIGRNKTKDISNSSYNNRSNTST
FT                   INNHNNNNINNNNNNINNNNNINNNSNIFNNNDNKKYSYIHNSNTTMMKPSNIILNHHH
FT                   NNNNNNNVTNNLGSTNFNVNNKVSSHSNLLYNNKNFSNNNNNNFFQNNNNNNNSSSSNN
FT                   RISNSNLAIEQNYCNQFLKSNDSKEGRNVVLSDNLPFVNNVKVDNDLNNKNIFNNYKTN
FT                   YNDKNFEQNNMNISGNSMNQFNNNMNSSGDNSFVGSVVSSVIGSTASNFFQNKFLNNKE
FT                   SNVESNKGIVHNIFERLTNDKESKNEINNLVQQKVANMVINEIEKKIEINQTSFICNKL
FT                   SVLREYFDVTHAYVIQKILFILIPYIYIRKALCESRTYYVYTHFKRKMESSEKNKTFNS
FT                   AFILNNDNSNFTRPNSSINNEYAQQQGGSFFYNDKSKGYMSNTHNNMNNNVNNNMNNNM
FT                   NNNMNNNMNNNMNNNMNNNMNNNMNNNMNNSMARHNSNDINYVDYSNVGIFKADLYIPL
FT                   MSSITYILLYTLTITAQKQNATFNPDNLFNISSYVFILLFLETAIIKFLFLLTCRDINL
FT                   SFLHILSFISYKFVIMCALIITKIFFYFLYFMYASVFGGGGTFPDISMKNNLHVNKKML
FT                   SNNSHNTFKNMNYQNISKFSPFNIVLFLNSTTTYRLTQLYFYITVTIQMIQIFKSIHLY
FT                   IHDNNSNLSHKVNIKRINVLILIFSLSQIFLCWILTPSFT"
     MSYNNNYVDF NIHDRRKTNN ANFKEEENSW SNMSFSKGNN LNNNVMKRGG HMDITNNKNF        60
     MDININDMNR MNNMNNFYSG HVTDVNNTEN DESAHLLNKN VQVDNTYVNN LINPNDNVTH       120
     PFAKNINNNT SSSNYVSAHP IIGRNKTKDI SNSSYNNRSN TSTINNHNNN NINNNNNNIN       180
     NNNNINNNSN IFNNNDNKKY SYIHNSNTTM MKPSNIILNH HHNNNNNNNV TNNLGSTNFN       240
     VNNKVSSHSN LLYNNKNFSN NNNNNFFQNN NNNNNSSSSN NRISNSNLAI EQNYCNQFLK       300
     SNDSKEGRNV VLSDNLPFVN NVKVDNDLNN KNIFNNYKTN YNDKNFEQNN MNISGNSMNQ       360
     FNNNMNSSGD NSFVGSVVSS VIGSTASNFF QNKFLNNKES NVESNKGIVH NIFERLTNDK       420
     ESKNEINNLV QQKVANMVIN EIEKKIEINQ TSFICNKLSV LREYFDVTHA YVIQKILFIL       480
     IPYIYIRKAL CESRTYYVYT HFKRKMESSE KNKTFNSAFI LNNDNSNFTR PNSSINNEYA       540
     QQQGGSFFYN DKSKGYMSNT HNNMNNNVNN NMNNNMNNNM NNNMNNNMNN NMNNNMNNNM       600
     NNNMNNSMAR HNSNDINYVD YSNVGIFKAD LYIPLMSSIT YILLYTLTIT AQKQNATFNP       660
     DNLFNISSYV FILLFLETAI IKFLFLLTCR DINLSFLHIL SFISYKFVIM CALIITKIFF       720
     YFLYFMYASV FGGGGTFPDI SMKNNLHVNK KMLSNNSHNT FKNMNYQNIS KFSPFNIVLF       780
     LNSTTTYRLT QLYFYITVTI QMIQIFKSIH LYIHDNNSNL SHKVNIKRIN VLILIFSLSQ       840
     IFLCWILTPS FT                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page