(data stored in ACNUC9543 zone)

EMBL: AL844507.PE202

AL844507.PE202       Location/Qualifiers
FT   CDS             join(929145..929616,929798..930212,930381..930861)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0820600"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0820600"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.56:mRNA"
FT                   /db_xref="GOA:Q8IB41"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB41"
FT                   /protein_id="CAD51168.1"
FT                   /translation="MNLFSFLIFLLLLFFINLFFVKSNFKNDESYNIPLNVLFNKGKNI
FT                   RKRVCNECFYKNEVSLIFNSCKVLENVKNNNLNKAKIMSFIRQSPKMIKSYVTLKYKSR
FT                   FSEILSAKYIKKFLSSKKMLIFDVLFLLGKTYFKYNIMLSILALFKTIFIRFLAVYITQ
FT                   LLSSFLLFHYVNMFSQRTQAYILFISGSNYSSRIIGFFQLNIINYYINIFSEAVQIGLI
FT                   RILFNQYEVEKIKSILYNSSDYYINTTLTNKYSIMYQCTKRFVISRFNKLSIFTFNYLR
FT                   YFVLTNLFFKLFEGTYNKYSPSDVKMPGVYSDKKKSLNKDMKYATKREINILKNFCKDT
FT                   GCHTCGMTCHEKFIGDHQPPVQIIKDMVNYYKKRKFILYFLKLFKLYDTKQRLYPQCIR
FT                   CSQLQSASVRCKKLRLIPHYKTIRMFHYSSIFHLFLKMLLLTNWKQIIFWDKNSIN"
     MNLFSFLIFL LLLFFINLFF VKSNFKNDES YNIPLNVLFN KGKNIRKRVC NECFYKNEVS        60
     LIFNSCKVLE NVKNNNLNKA KIMSFIRQSP KMIKSYVTLK YKSRFSEILS AKYIKKFLSS       120
     KKMLIFDVLF LLGKTYFKYN IMLSILALFK TIFIRFLAVY ITQLLSSFLL FHYVNMFSQR       180
     TQAYILFISG SNYSSRIIGF FQLNIINYYI NIFSEAVQIG LIRILFNQYE VEKIKSILYN       240
     SSDYYINTTL TNKYSIMYQC TKRFVISRFN KLSIFTFNYL RYFVLTNLFF KLFEGTYNKY       300
     SPSDVKMPGV YSDKKKSLNK DMKYATKREI NILKNFCKDT GCHTCGMTCH EKFIGDHQPP       360
     VQIIKDMVNY YKKRKFILYF LKLFKLYDTK QRLYPQCIRC SQLQSASVRC KKLRLIPHYK       420
     TIRMFHYSSI FHLFLKMLLL TNWKQIIFWD KNSIN                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page