(data stored in SCRATCH zone)

EMBL: AL844507.PE205

AL844507.PE205       Location/Qualifiers
FT   CDS             complement(join(939583..940898,941076..943742,
FT                   943898..944645))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0820900"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0820900"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.54:mRNA"
FT                   /db_xref="GOA:Q8IB43"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB43"
FT                   /protein_id="CAD51165.1"
FT                   /translation="MKDNKMSKNNIFIYNEKVKELLYELILLTNKLSIYRKKYIKYIRR
FT                   KIDYDKYKYKSKFNNNDDNYAFLLFKNFNYHNEFLIHKYVKFKEGKRRYISNGKYKKEF
FT                   NSSYDILEYYDKFINNLLYLCNNHTDIYIEFLYVLLINSQLFNRFLFLSTYISGDKKDQ
FT                   FLYLIYNHFLILVEYYHYYKNSSYYDDLYNNLKNTYDKIQTKHNDKEHYIEIKNKNQNH
FT                   KRGNHNNLSCNTGLETNSVSPIQNFKKDPNTHTYKNFYKKERVKFLYNYSNKRNENFFT
FT                   INNCNSSSNECNQSFSEYEPLNKEAHEKSIFFNKEENVYYVDDDKNDNNLFNENVHKKK
FT                   KGKETKNIFNKFFFNLSESQNSLTNLYQNFYSKNKNRSYDSQFIDTKKRNSLQNKCFIF
FT                   TNVNNFNIKEYYKLKHIFSIFQKLKIEHLYILLYFSLSILSTLFHIYLTRIMLNRKNPF
FT                   FISTYLFYLSKKVKNKIFNNLYKYIQPNKDYMNRYMFKSDDMQEQKKKIINNDILINEY
FT                   VSNQIGNSVNEGKLYINVTKNNNNNNNNNKDKDNYDDDNNNCHVQEKDITYQDLSIHYL
FT                   INKYKHNIDNQFVNLYYKNKHNTSNDSITLFNHLTCENSLQNLNKIYVNHIINKFSKEK
FT                   ENDIDNMDSFNYDIKMLHTFQLQDNLKKLNFQILNTKHENYILEECNGVLENIINKEEY
FT                   NIISEEDEKIKDKANKNEKRQSSNQYNHNDDTIPYIHITEHKNDIIKENSKSNDEPIEG
FT                   CKKYEKSKKSINIPEQYINNDKFYKFIEHHLEMKYIYLYYKNIEKDKLLNYVGFENLIK
FT                   SLSIMCNEHFFSFYMNKINVKNMYEDNDNILNEAHNVNKHTIKTKIEKNKKHEEKNNKH
FT                   EEKNKKHEEKNKKHEEKNKKHEEKNKKHEEKNKKHEEKNPHESDDEEEEEEDNIDTLHL
FT                   NSIYKEPTLINNEYIKKKIKRNKLYTYKLFNNQIETLLNSKELMEYIKKQKEIKKKKNK
FT                   SELQNDDFLYIQSQNGNNVINNKDQHIYNDIFKFIQNKNYHNKNDDIIHTNCSSYENSD
FT                   SSDNLTLYNYSKNYYHQNNIILDSFLFFIIHIFYTFLHFHNVYFSSPYLNLFLSFSIKL
FT                   IYKYKNVVQCQSNDYNIDMSLDPSVLSYEKRENGPTINYDLPEQNIHSSNKPCNQINLL
FT                   RRKKNIQKTCTLYNNSKNHIYNACSSEDITSINEEVFNAPNIIELIIKKQKFINKKQKK
FT                   NYSFIGNDIFLFGKDKTKEFLPNTFDIIINSFFDLCISICSMNFKYISQKKQKLNMSYF
FT                   CNNIIFYHHIINKSYNDKALDLFNRNNYNHSLECYSYYFDELKNDQSFINHFGKYKNTD
FT                   TIFRHNIASQKKKKIINNKNKIISNIHKNNNHINDMIGMYKTKELSSNSSNILNENNLI
FT                   KRKSKEKKKESNHKNENSNNSFDGTSNYYNDDNNYNTYLSFSSDESLNFLKYIKKRTTN
FT                   RIYIDENNIINMLINIGCIFMNNIKYNAAITLNHIYKINQYDLLSDRQKFYHYIQKSFY
FT                   NNKHMTFPYIYNQYFISFFFFFKIHYLFFLIKFKCENEIFLKAYWFLHAVYNITQN"
     MKDNKMSKNN IFIYNEKVKE LLYELILLTN KLSIYRKKYI KYIRRKIDYD KYKYKSKFNN        60
     NDDNYAFLLF KNFNYHNEFL IHKYVKFKEG KRRYISNGKY KKEFNSSYDI LEYYDKFINN       120
     LLYLCNNHTD IYIEFLYVLL INSQLFNRFL FLSTYISGDK KDQFLYLIYN HFLILVEYYH       180
     YYKNSSYYDD LYNNLKNTYD KIQTKHNDKE HYIEIKNKNQ NHKRGNHNNL SCNTGLETNS       240
     VSPIQNFKKD PNTHTYKNFY KKERVKFLYN YSNKRNENFF TINNCNSSSN ECNQSFSEYE       300
     PLNKEAHEKS IFFNKEENVY YVDDDKNDNN LFNENVHKKK KGKETKNIFN KFFFNLSESQ       360
     NSLTNLYQNF YSKNKNRSYD SQFIDTKKRN SLQNKCFIFT NVNNFNIKEY YKLKHIFSIF       420
     QKLKIEHLYI LLYFSLSILS TLFHIYLTRI MLNRKNPFFI STYLFYLSKK VKNKIFNNLY       480
     KYIQPNKDYM NRYMFKSDDM QEQKKKIINN DILINEYVSN QIGNSVNEGK LYINVTKNNN       540
     NNNNNNKDKD NYDDDNNNCH VQEKDITYQD LSIHYLINKY KHNIDNQFVN LYYKNKHNTS       600
     NDSITLFNHL TCENSLQNLN KIYVNHIINK FSKEKENDID NMDSFNYDIK MLHTFQLQDN       660
     LKKLNFQILN TKHENYILEE CNGVLENIIN KEEYNIISEE DEKIKDKANK NEKRQSSNQY       720
     NHNDDTIPYI HITEHKNDII KENSKSNDEP IEGCKKYEKS KKSINIPEQY INNDKFYKFI       780
     EHHLEMKYIY LYYKNIEKDK LLNYVGFENL IKSLSIMCNE HFFSFYMNKI NVKNMYEDND       840
     NILNEAHNVN KHTIKTKIEK NKKHEEKNNK HEEKNKKHEE KNKKHEEKNK KHEEKNKKHE       900
     EKNKKHEEKN PHESDDEEEE EEDNIDTLHL NSIYKEPTLI NNEYIKKKIK RNKLYTYKLF       960
     NNQIETLLNS KELMEYIKKQ KEIKKKKNKS ELQNDDFLYI QSQNGNNVIN NKDQHIYNDI      1020
     FKFIQNKNYH NKNDDIIHTN CSSYENSDSS DNLTLYNYSK NYYHQNNIIL DSFLFFIIHI      1080
     FYTFLHFHNV YFSSPYLNLF LSFSIKLIYK YKNVVQCQSN DYNIDMSLDP SVLSYEKREN      1140
     GPTINYDLPE QNIHSSNKPC NQINLLRRKK NIQKTCTLYN NSKNHIYNAC SSEDITSINE      1200
     EVFNAPNIIE LIIKKQKFIN KKQKKNYSFI GNDIFLFGKD KTKEFLPNTF DIIINSFFDL      1260
     CISICSMNFK YISQKKQKLN MSYFCNNIIF YHHIINKSYN DKALDLFNRN NYNHSLECYS      1320
     YYFDELKNDQ SFINHFGKYK NTDTIFRHNI ASQKKKKIIN NKNKIISNIH KNNNHINDMI      1380
     GMYKTKELSS NSSNILNENN LIKRKSKEKK KESNHKNENS NNSFDGTSNY YNDDNNYNTY      1440
     LSFSSDESLN FLKYIKKRTT NRIYIDENNI INMLINIGCI FMNNIKYNAA ITLNHIYKIN      1500
     QYDLLSDRQK FYHYIQKSFY NNKHMTFPYI YNQYFISFFF FFKIHYLFFL IKFKCENEIF      1560
     LKAYWFLHAV YNITQN                                                      1576
//

If you have problems or comments...

PBIL Back to PBIL home page