(data stored in ACNUC9543 zone)

EMBL: AL844507.PE206

AL844507.PE206       Location/Qualifiers
FT   CDS             join(948745..949909,950078..950180,950274..950344,
FT                   950485..950609,950819..950899)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0821000"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0821000"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.53:mRNA"
FT                   /db_xref="GOA:Q8IB44"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB44"
FT                   /protein_id="CAD51164.1"
FT                   /translation="MESMPSETTINSEQYKSKESNNICRNEKSTAYSENSDISNNKEDY
FT                   NSDRKENFDKKLCDNMNDKINIYDNIISEIKELYNGNIVMNNKGLDKLNIRNVAKGLFL
FT                   NINKTISKKVRVLVIGNSSSGKSTFINWFLQENIQKTGYEYETNNFTLITSGNYFSEFN
FT                   GDITVRTFDFLKQISNRNRNFKNNLCTKMYVSKNMETKNIDFIDTPGLKDIMNKLDFDI
FT                   NSIIYDLSDYVDIILVFFDSSGKSLSNRLLLIIKEIYEKHMEKIIFIFSKIDEIKHEED
FT                   RIKLLCQTTQCLTTKINIRHNIDLLPIYIHGAKTGRYLFESNKNSDELCIVNRINDIIY
FT                   EIKKLFFKKLERDLYCLINDCDSIINKILDILKTDGERRMHKYSLKRERVKHTVIQVFL
FT                   FLVFMLLLFMQLPEQNYYKGLLLSHFNFGNNSVYIKYIKNTGVMLNNWENSYIMINVIL
FT                   VFFFLLSGIMKKKFSKNIKTLHVSSKEILREQLTFAKFAKDRGKYLAKTFYELKQT"
     MESMPSETTI NSEQYKSKES NNICRNEKST AYSENSDISN NKEDYNSDRK ENFDKKLCDN        60
     MNDKINIYDN IISEIKELYN GNIVMNNKGL DKLNIRNVAK GLFLNINKTI SKKVRVLVIG       120
     NSSSGKSTFI NWFLQENIQK TGYEYETNNF TLITSGNYFS EFNGDITVRT FDFLKQISNR       180
     NRNFKNNLCT KMYVSKNMET KNIDFIDTPG LKDIMNKLDF DINSIIYDLS DYVDIILVFF       240
     DSSGKSLSNR LLLIIKEIYE KHMEKIIFIF SKIDEIKHEE DRIKLLCQTT QCLTTKINIR       300
     HNIDLLPIYI HGAKTGRYLF ESNKNSDELC IVNRINDIIY EIKKLFFKKL ERDLYCLIND       360
     CDSIINKILD ILKTDGERRM HKYSLKRERV KHTVIQVFLF LVFMLLLFMQ LPEQNYYKGL       420
     LLSHFNFGNN SVYIKYIKNT GVMLNNWENS YIMINVILVF FFLLSGIMKK KFSKNIKTLH       480
     VSSKEILREQ LTFAKFAKDR GKYLAKTFYE LKQT                                   514
//

If you have problems or comments...

PBIL Back to PBIL home page