(data stored in ACNUC9543 zone)

EMBL: AL844507.PE207

AL844507.PE207       Location/Qualifiers
FT   CDS             join(953448..955665,955776..956314)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0821100"
FT                   /product="protein kinase 1"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0821100"
FT                   /db_xref="GOA:C0H4W5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4W5"
FT                   /protein_id="CAX64143.2"
FT                   /translation="MDLIKIYKRNEIIKDYVNIYFDDEKSENSNKNLSYKILHIIGNGV
FT                   YGVVYKADCLNNCSIVALKQTYQKSTRIFKEIEIMKKLKHPNIVKLKHAFYTSTNDGGV
FT                   YVHMVMEYGNTDLASSLYYITLKDSKEFLKDSFDLDNYNYEDYDDNKSEKDMLPNDQQK
FT                   SDFYYYRSLPNQNEEMTADEKSGIHPGNNNMIVQGMINSNNNNNRDNNGDNNSSNNNSS
FT                   NNNSSNNNSSNNNSSNNNSSNNNSSNNNSSSSSSSSVLNDVHVNNTPSDEDMESCNYIK
FT                   NNRRINIINHFKNSFFNENINNICSCHNISDFIKKSFLNENQIKIYLYQLIRATLYLHS
FT                   LCITHRDIKPQNILIFLNKTNKMKTNKTYINNKKCLICIQNNFNIQYIMKKKYNNQFNM
FT                   FEFNNDMKDTRDEICNLDKTSDICDMSCDDKILNGDGISSCHKINNYNNILYNSHNKST
FT                   NEQNYCEEVRNHDHVNDPCYNISNIKNNIHDKNKKENHTIDDDIQGNDNYSLKNEGQDD
FT                   LQVCKNNDKKKKDLFVQEMQLCDKNKYEGSTSPSNDYNKYDKDCYNNNNLMSNHDDCSA
FT                   KNNLRLKRLVSMTNLNQRNYYMIINDNTDKICDKSITYDDDITKKKNKANINKLNIDKS
FT                   KNDIISENKDTQIAPPNNSNNNNNNNCGDDDNFNHDDLPDQQSLDKLYINSLMYKYIKL
FT                   CDFNTSIKLKENYKYFSYVCSRYYRAPELLFGSNYYSQAIDTWSIGCVMGELLLGKPLF
FT                   LGECASDQLVEIIKILGTPNDEDFLSFRSVYKNIKFPDIKPITLEKVIRHNCSKESLDL
FT                   LSELLQFNPQKRIKLCHALLHNYFDDIRNLKVFQKDINTFDKYKLPYNTNCFNFTKEEL
FT                   LHFTIEERKILIPQHVRQNKSDEVMQYIDMTPDHFDKLYPNKIHLTC"
     MDLIKIYKRN EIIKDYVNIY FDDEKSENSN KNLSYKILHI IGNGVYGVVY KADCLNNCSI        60
     VALKQTYQKS TRIFKEIEIM KKLKHPNIVK LKHAFYTSTN DGGVYVHMVM EYGNTDLASS       120
     LYYITLKDSK EFLKDSFDLD NYNYEDYDDN KSEKDMLPND QQKSDFYYYR SLPNQNEEMT       180
     ADEKSGIHPG NNNMIVQGMI NSNNNNNRDN NGDNNSSNNN SSNNNSSNNN SSNNNSSNNN       240
     SSNNNSSNNN SSSSSSSSVL NDVHVNNTPS DEDMESCNYI KNNRRINIIN HFKNSFFNEN       300
     INNICSCHNI SDFIKKSFLN ENQIKIYLYQ LIRATLYLHS LCITHRDIKP QNILIFLNKT       360
     NKMKTNKTYI NNKKCLICIQ NNFNIQYIMK KKYNNQFNMF EFNNDMKDTR DEICNLDKTS       420
     DICDMSCDDK ILNGDGISSC HKINNYNNIL YNSHNKSTNE QNYCEEVRNH DHVNDPCYNI       480
     SNIKNNIHDK NKKENHTIDD DIQGNDNYSL KNEGQDDLQV CKNNDKKKKD LFVQEMQLCD       540
     KNKYEGSTSP SNDYNKYDKD CYNNNNLMSN HDDCSAKNNL RLKRLVSMTN LNQRNYYMII       600
     NDNTDKICDK SITYDDDITK KKNKANINKL NIDKSKNDII SENKDTQIAP PNNSNNNNNN       660
     NCGDDDNFNH DDLPDQQSLD KLYINSLMYK YIKLCDFNTS IKLKENYKYF SYVCSRYYRA       720
     PELLFGSNYY SQAIDTWSIG CVMGELLLGK PLFLGECASD QLVEIIKILG TPNDEDFLSF       780
     RSVYKNIKFP DIKPITLEKV IRHNCSKESL DLLSELLQFN PQKRIKLCHA LLHNYFDDIR       840
     NLKVFQKDIN TFDKYKLPYN TNCFNFTKEE LLHFTIEERK ILIPQHVRQN KSDEVMQYID       900
     MTPDHFDKLY PNKIHLTC                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page