(data stored in ACNUC9543 zone)

EMBL: AL844507.PE210

AL844507.PE210       Location/Qualifiers
FT   CDS             join(965822..965890,966352..966657)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0821400"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0821400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.52:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB48"
FT                   /protein_id="CAD51160.1"
FT                   /translation="MTKVNKPPVTVNKIKKPNSKEEEEINQPVKKTLIAKNNNPPTPVN
FT                   KVIKKPDEKVCSSNTDSQKKSDGTDDKSKKDGQGTDKTKGTNSDSKSKNNDDNKSNVQK
FT                   YGYFSWLWKYFQPKKTEVKK"
     MTKVNKPPVT VNKIKKPNSK EEEEINQPVK KTLIAKNNNP PTPVNKVIKK PDEKVCSSNT        60
     DSQKKSDGTD DKSKKDGQGT DKTKGTNSDS KSKNNDDNKS NVQKYGYFSW LWKYFQPKKT       120
     EVKK                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page