(data stored in ACNUC9543 zone)

EMBL: AL844507.PE211

AL844507.PE211       Location/Qualifiers
FT   CDS             complement(967901..968740)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0821500"
FT                   /product="ribosomal RNA small subunit methyltransferase
FT                   NEP1, putative"
FT                   /EC_number="2.1.1.260"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0821500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0041:mRNA"
FT                   /db_xref="GOA:Q8IB49"
FT                   /db_xref="InterPro:IPR005304"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB49"
FT                   /protein_id="CAD51159.1"
FT                   /translation="MENKQDDENSVNIKESILLSELSDDPNDYDQNNYDQNNYDQNNYD
FT                   QNVYDQNGYDPNDYDDEQRKKKKVIIILEGACLQLIEVKRFIYELANSRKHKNILKKNK
FT                   VDEENIKNFRPDILHQCLIHLLESPLNKFGYLQIYIKTHDNQLFYVSSNLKIPKTFQQF
FT                   ESLMVTFLRKYKIKANEKNIYLLKIIKNDLQNILPINGHKIGLSLKGKKVELNNYIKVY
FT                   KNTNQPVTFFIGAVAYSNPTMKLQILDDNISISDFSLSAAMCCSSICSEFEHLWNLF"
     MENKQDDENS VNIKESILLS ELSDDPNDYD QNNYDQNNYD QNNYDQNVYD QNGYDPNDYD        60
     DEQRKKKKVI IILEGACLQL IEVKRFIYEL ANSRKHKNIL KKNKVDEENI KNFRPDILHQ       120
     CLIHLLESPL NKFGYLQIYI KTHDNQLFYV SSNLKIPKTF QQFESLMVTF LRKYKIKANE       180
     KNIYLLKIIK NDLQNILPIN GHKIGLSLKG KKVELNNYIK VYKNTNQPVT FFIGAVAYSN       240
     PTMKLQILDD NISISDFSLS AAMCCSSICS EFEHLWNLF                              279
//

If you have problems or comments...

PBIL Back to PBIL home page