(data stored in ACNUC9543 zone)

EMBL: AL844507.PE212

AL844507.PE212       Location/Qualifiers
FT   CDS             969690..971714
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0821600"
FT                   /product="polyribonucleotide 5'-hydroxyl-kinase Clp1,
FT                   putative"
FT                   /EC_number="2.7.1.78"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0821600"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0040:mRNA"
FT                   /db_xref="GOA:Q8IB50"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="InterPro:IPR032324"
FT                   /db_xref="InterPro:IPR038239"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB50"
FT                   /protein_id="CAD51158.1"
FT                   /translation="MANNGNTRLYHLKAYHELRIVTLEKSTKYNEKEECIKIRILSSKN
FT                   IHHKSNERKNPTDNINYSAEIFGKELILDKDYTFGYNEKFSIYTYTGCYIQIKGITLQE
FT                   YESKNNTMKEYVSLCYILDAYRKLAKKKKKIGPRILITGNNNSGKSSVSLLLLNYALKS
FT                   GFKPLYIETDTKASSDKVELNRGPGVISCFKYDNMNNIVSMYPMASLNNINNNINNNNN
FT                   NNNNNNNNSNNVELVNNNNTINVNNNMFDSYMKYSLEYFFGYYDIKEDLNLYYHLNECI
FT                   SSCIYLMFLNNINNESTDLRNYSNEQEHICSSGFILNVPSEADHEIVQNMIDIYNINIV
FT                   IIIDNSFLHYSLKKYYHNINEDQQEYNNVEKENNLIKDRDKKSKQTNRLSEHNLLYDMN
FT                   VFNDKDVNPDMRGSTVFTKNKGEDGFYDDQKNEELKRGNYNNININNNNNNNNYYYNND
FT                   NVNNMYNMMYNNHQEDEEKKNIQIIGMPKFEGVIPSDNNRIKYCRNLWYYNYFSRDINI
FT                   NNYAFKKSHILSFKYSRTNFVKLDTNLAVPLSALPSDCRDIKRENVSVSLYNGNVKNLI
FT                   NCILAVSYSKDFTYVHLINIAALIHVQGIKEVEKTQQKQDNEKDKEKENNNSYVNQDGN
FT                   NTEQHQVDYIFDILCPTYITLKNLPPFFIIPGNIRQMKF"
     MANNGNTRLY HLKAYHELRI VTLEKSTKYN EKEECIKIRI LSSKNIHHKS NERKNPTDNI        60
     NYSAEIFGKE LILDKDYTFG YNEKFSIYTY TGCYIQIKGI TLQEYESKNN TMKEYVSLCY       120
     ILDAYRKLAK KKKKIGPRIL ITGNNNSGKS SVSLLLLNYA LKSGFKPLYI ETDTKASSDK       180
     VELNRGPGVI SCFKYDNMNN IVSMYPMASL NNINNNINNN NNNNNNNNNN SNNVELVNNN       240
     NTINVNNNMF DSYMKYSLEY FFGYYDIKED LNLYYHLNEC ISSCIYLMFL NNINNESTDL       300
     RNYSNEQEHI CSSGFILNVP SEADHEIVQN MIDIYNINIV IIIDNSFLHY SLKKYYHNIN       360
     EDQQEYNNVE KENNLIKDRD KKSKQTNRLS EHNLLYDMNV FNDKDVNPDM RGSTVFTKNK       420
     GEDGFYDDQK NEELKRGNYN NININNNNNN NNYYYNNDNV NNMYNMMYNN HQEDEEKKNI       480
     QIIGMPKFEG VIPSDNNRIK YCRNLWYYNY FSRDININNY AFKKSHILSF KYSRTNFVKL       540
     DTNLAVPLSA LPSDCRDIKR ENVSVSLYNG NVKNLINCIL AVSYSKDFTY VHLINIAALI       600
     HVQGIKEVEK TQQKQDNEKD KEKENNNSYV NQDGNNTEQH QVDYIFDILC PTYITLKNLP       660
     PFFIIPGNIR QMKF                                                         674
//

If you have problems or comments...

PBIL Back to PBIL home page