(data stored in ACNUC9543 zone)

EMBL: AL844507.PE213

AL844507.PE213       Location/Qualifiers
FT   CDS             join(973586..973765,973866..973997,974160..974267)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0821700"
FT                   /product="60S ribosomal protein L22, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0821700"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0039:mRNA"
FT                   /db_xref="GOA:Q8IB51"
FT                   /db_xref="InterPro:IPR002671"
FT                   /db_xref="InterPro:IPR038526"
FT                   /db_xref="PDB:3J79"
FT                   /db_xref="PDB:3JBN"
FT                   /db_xref="PDB:3JBO"
FT                   /db_xref="PDB:3JBP"
FT                   /db_xref="PDB:5UMD"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB51"
FT                   /protein_id="CAD51157.1"
FT                   /translation="MVAKKDSTKVSKKLKKKVVKKTKIVKGLKKQKMNKSTKGIKYVLD
FT                   CTKPVKDTILDISGLEQFFKDKIKVDKKTNNLKNKVVVTSDEYKIYITVHIPFSKRYIK
FT                   YLAKKYIKMHQIRDFLRVIAKGKLAYEFKYFQLNN"
     MVAKKDSTKV SKKLKKKVVK KTKIVKGLKK QKMNKSTKGI KYVLDCTKPV KDTILDISGL        60
     EQFFKDKIKV DKKTNNLKNK VVVTSDEYKI YITVHIPFSK RYIKYLAKKY IKMHQIRDFL       120
     RVIAKGKLAY EFKYFQLNN                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page