(data stored in ACNUC9543 zone)

EMBL: AL844507.PE214

AL844507.PE214       Location/Qualifiers
FT   CDS             join(976074..976120,976358..976474,976566..976644)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0821800"
FT                   /product="protein transport protein SEC61 subunit beta,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0821800"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.51:mRNA"
FT                   /db_xref="GOA:C0H4W6"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="InterPro:IPR030671"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4W6"
FT                   /protein_id="CAX64144.1"
FT                   /translation="MNAAPVIVGGMRTPARRRQSNASANGNNSKQRRNSNGNSNSIVKF
FT                   YGDDSPGFKLTPQTVLISTLIFMASVVILHIISKI"
     MNAAPVIVGG MRTPARRRQS NASANGNNSK QRRNSNGNSN SIVKFYGDDS PGFKLTPQTV        60
     LISTLIFMAS VVILHIISKI                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page