(data stored in ACNUC9543 zone)

EMBL: AL844507.PE215

AL844507.PE215       Location/Qualifiers
FT   CDS             complement(join(977432..977539,977712..977769,
FT                   977890..977975,978117..978188))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0821900"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0821900"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.50:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4W7"
FT                   /protein_id="CAX64145.1"
FT                   /translation="MIKLFQINKRFIYWPPKNKLRTLRFPSGKKSFIFVGKRDEDGKEE
FT                   PVLCFVDNQNQKLTWMNEEEVLNFEKLMPRLDSYFSLYIQKAQKVNEQNMQLIEEMHKT
FT                   YHE"
     MIKLFQINKR FIYWPPKNKL RTLRFPSGKK SFIFVGKRDE DGKEEPVLCF VDNQNQKLTW        60
     MNEEEVLNFE KLMPRLDSYF SLYIQKAQKV NEQNMQLIEE MHKTYHE                     107
//

If you have problems or comments...

PBIL Back to PBIL home page