(data stored in SCRATCH zone)

EMBL: AL844507.PE216

AL844507.PE216       Location/Qualifiers
FT   CDS             join(978798..980376,980507..980634)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0822000"
FT                   /product="ribosomal protein L4, mitochondrial, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0822000"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0038:mRNA"
FT                   /db_xref="GOA:Q8IB54"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB54"
FT                   /protein_id="CAD51154.1"
FT                   /translation="MHLTNKLTKNISFFYHVPLFQKRKLTTFALRKKYIWKNNTHTKKN
FT                   DEKKIMTCSGDFIEKKKKNYEWEIERKEEEEEEEEEQDEECSENDIEVMNKEVACNINN
FT                   DIKIKENNKINVDDDISVCDEYKFLFERPKHFAHIDDEPIIRRPGCIIDIKTLLRNNWS
FT                   FPAVGFNSKLEIPIYKFEADENDDNIKYISVPNDIFGLPIRSDILHKCYYFYRTALAGY
FT                   TERMQLYKWEWPGSTKKYRSQKKSGKARMNWRKTCGRYLGVKNHPIRPFDQKTNINRKF
FT                   LWKGMKILLSAKFAQDQIKVVDNFLIKSHKTKYTVKYLRNILGKNCNSALLVHEGKTDV
FT                   NDNFLWACANIASVKRENVEGVNIYNLLKYRYVVFTYKALKNIIYELKIYPYKMKWLPT
FT                   YATPNNTQAPIPEKVKNWNFLWLEKKKRNNFSKFDKETLKKRIQEWKWSSDIKGALKVK
FT                   KHDPYKNFILTKFQCNDPVPEYIKYEYLFNVDDDPHEDNDYEEHFHMLDEILNDDEDLP
FT                   TISSLSSLQGLEKDDNVQSEEHYEDDIYNDEGVNDINEDELGNINFEDTKD"
     MHLTNKLTKN ISFFYHVPLF QKRKLTTFAL RKKYIWKNNT HTKKNDEKKI MTCSGDFIEK        60
     KKKNYEWEIE RKEEEEEEEE EQDEECSEND IEVMNKEVAC NINNDIKIKE NNKINVDDDI       120
     SVCDEYKFLF ERPKHFAHID DEPIIRRPGC IIDIKTLLRN NWSFPAVGFN SKLEIPIYKF       180
     EADENDDNIK YISVPNDIFG LPIRSDILHK CYYFYRTALA GYTERMQLYK WEWPGSTKKY       240
     RSQKKSGKAR MNWRKTCGRY LGVKNHPIRP FDQKTNINRK FLWKGMKILL SAKFAQDQIK       300
     VVDNFLIKSH KTKYTVKYLR NILGKNCNSA LLVHEGKTDV NDNFLWACAN IASVKRENVE       360
     GVNIYNLLKY RYVVFTYKAL KNIIYELKIY PYKMKWLPTY ATPNNTQAPI PEKVKNWNFL       420
     WLEKKKRNNF SKFDKETLKK RIQEWKWSSD IKGALKVKKH DPYKNFILTK FQCNDPVPEY       480
     IKYEYLFNVD DDPHEDNDYE EHFHMLDEIL NDDEDLPTIS SLSSLQGLEK DDNVQSEEHY       540
     EDDIYNDEGV NDINEDELGN INFEDTKD                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page