(data stored in ACNUC9543 zone)

EMBL: AL844507.PE217

AL844507.PE217       Location/Qualifiers
FT   CDS             complement(981018..981722)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0822100"
FT                   /product="mediator of RNA polymerase II transcription
FT                   subunit 7, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0822100"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0037:mRNA"
FT                   /db_xref="GOA:Q8IB55"
FT                   /db_xref="InterPro:IPR009244"
FT                   /db_xref="InterPro:IPR037212"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB55"
FT                   /protein_id="CAD51153.1"
FT                   /translation="MADENYVSGYPPPPYYYKEYQSVDIKKLMEMSNFKSTDEKSFLEH
FT                   MKNSYDVIYDVDTNTYIKNIESIDNIKNCNFIMGRPPPLPLRNSYNVFGIDYELQRNIE
FT                   ELDSDEILYDEKKNLKEEFIRLYKIYKETFFLLFDDIVNNRKDDKSKIKHLTKIHVNLF
FT                   HILAKLRHYQTINNIINVLKIQLKKRQIAIDKMKISLLNVYQYINFVQTNYGNNKMIKN
FT                   EENQEKKNKKKN"
     MADENYVSGY PPPPYYYKEY QSVDIKKLME MSNFKSTDEK SFLEHMKNSY DVIYDVDTNT        60
     YIKNIESIDN IKNCNFIMGR PPPLPLRNSY NVFGIDYELQ RNIEELDSDE ILYDEKKNLK       120
     EEFIRLYKIY KETFFLLFDD IVNNRKDDKS KIKHLTKIHV NLFHILAKLR HYQTINNIIN       180
     VLKIQLKKRQ IAIDKMKISL LNVYQYINFV QTNYGNNKMI KNEENQEKKN KKKN             234
//

If you have problems or comments...

PBIL Back to PBIL home page