(data stored in ACNUC9543 zone)

EMBL: AL844507.PE218

AL844507.PE218       Location/Qualifiers
FT   CDS             join(982570..986562,986763..987166,987561..987696)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0822200"
FT                   /product="phosphorylated CTD interacting factor 1 WW
FT                   domain-containing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0822200"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.49:mRNA"
FT                   /db_xref="GOA:C0H4W8"
FT                   /db_xref="InterPro:IPR022035"
FT                   /db_xref="InterPro:IPR039881"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4W8"
FT                   /protein_id="CAX64146.2"
FT                   /translation="MLDIKDEYKLQDEFIKLRRILINIFCYELFYSPNKKLKNRLLYII
FT                   RKSECYKKCCFLFNGEYNNVHNDDEFCVCAYKKYRQKINKIFKRFMMKKNKYNKRKKKE
FT                   KDNKLYTYCELRKNICFMEKEIFNRLFFNINIRYSNYVIERKYMYLYFLFIKFMGVLKK
FT                   KKKQYIINNNNNNVSKKDKPCCFIDSLLSHFCIKQFSLFINYLLKGKRDNIYFELLKGE
FT                   IKSTFFNLNIDKNRYKKENVHIYQKKYTNFCHSIVIYKYKPIIKYEKKIHNNINKKKIY
FT                   IYYYIKYLLQKKNNSYNFSINRFYYIKHRNRTQDIFLNIPKKKNIYIFSVNINSFKCVI
FT                   NKFIYNDFYYNLLNSIFYSIINIPLQYVCDTYIYYLYCYDSDLKNDENLLCVHEEYNNN
FT                   INKNMENNNNINKNMENNNNINKNMVNNYNNNNDIYNDIYNDIYNYNHIYNYNHIYNYN
FT                   HIYNYNHIYNDNNKTDKCNNTCNIKKHKDKFIHFLKYLFISSDQYEKDIKNNLPYSQRS
FT                   FLFYFINHIKGLLKNNIRNMLYLTISNVHKIIYNDMSLEYIFYLFLFYFIFLDIKIYCT
FT                   IFINLEKTSLSYEEIKIFKYFIKGSTDHIKNEKTKKKKKKKSNIKNDICNNIKNTNVYN
FT                   PTKNYNYNNNNNEKVSDYFHICLICSYNILNQDKIFMMEKIKILFYIIYYILYINHFSC
FT                   DKNQHDTFLRYFLFYTFQKKSTLFNIYPLLSKTQKWLPDEYKDNLLINYVVHTCCSFTK
FT                   KKIQKDLKKYLIKLLISKKHKYYQYFIKLLNEEDKNIAYFKKDIFKNTHAINEYKNIHY
FT                   NKNTKNEQIYNNFINNNYKVKYNHEIISSINKNSFVKDQRIYLYNKQILYYQQQFYNYV
FT                   FYMFRTFYENLKLFLLPLLQNIYHNRLIYINVYMYLFMIRSYYYIQKKKKINIKNVKCE
FT                   KCKIYKKCKKYQNNICYYYYYYYYYYRNNNYNNKLLINYSSEGQVLNIKDITCTKKSKE
FT                   RKQSIILKYYIINLCIHLYNYYLFMLKKNKVKKCNKMFLRKYLKLLLYIGRNILHICTH
FT                   PQHYIPFLCKMINFVNMYIYKYVECYNDISCIYSIKNEKMKYKNRSPSILYRFFLITKQ
FT                   TTNMSIHNIKKKKKKKNFCKKNKTYFIITNGNHNIYLEKYIKKILLNKGVQNIFHNIYV
FT                   HIKEDSFSVQTKQNFIIFKLKYKEDDNTNTLQNIYYQINGKKYFVFDNLYKLKKTYKIN
FT                   YIILCLLFYRYCYFFYTYNSFIFSYLFTNIFCICIDCLNKYVIVKNCQDKKKERCQDNS
FT                   HDCFYKQNGILKKNRNHILIKNFYYLIFFLLIRYHTIIGNISHSGLQNCIPKRIMNALK
FT                   KYMNVNVECFSSPFNSVLENYCSFFSDIDIFFGSKGDFFKYTLKSGVYEVNPPFDIFLI
FT                   NKLIIYILFKLKMDVNHLTFFLIIPYMKDINYYYELLFSSSYLSHFFILQRNTYTFSTR
FT                   LFEGRENEYISTCDCFVFILQNKKAQIENRIPKKRVLKIKKLWQNVDHI"
     MLDIKDEYKL QDEFIKLRRI LINIFCYELF YSPNKKLKNR LLYIIRKSEC YKKCCFLFNG        60
     EYNNVHNDDE FCVCAYKKYR QKINKIFKRF MMKKNKYNKR KKKEKDNKLY TYCELRKNIC       120
     FMEKEIFNRL FFNINIRYSN YVIERKYMYL YFLFIKFMGV LKKKKKQYII NNNNNNVSKK       180
     DKPCCFIDSL LSHFCIKQFS LFINYLLKGK RDNIYFELLK GEIKSTFFNL NIDKNRYKKE       240
     NVHIYQKKYT NFCHSIVIYK YKPIIKYEKK IHNNINKKKI YIYYYIKYLL QKKNNSYNFS       300
     INRFYYIKHR NRTQDIFLNI PKKKNIYIFS VNINSFKCVI NKFIYNDFYY NLLNSIFYSI       360
     INIPLQYVCD TYIYYLYCYD SDLKNDENLL CVHEEYNNNI NKNMENNNNI NKNMENNNNI       420
     NKNMVNNYNN NNDIYNDIYN DIYNYNHIYN YNHIYNYNHI YNYNHIYNDN NKTDKCNNTC       480
     NIKKHKDKFI HFLKYLFISS DQYEKDIKNN LPYSQRSFLF YFINHIKGLL KNNIRNMLYL       540
     TISNVHKIIY NDMSLEYIFY LFLFYFIFLD IKIYCTIFIN LEKTSLSYEE IKIFKYFIKG       600
     STDHIKNEKT KKKKKKKSNI KNDICNNIKN TNVYNPTKNY NYNNNNNEKV SDYFHICLIC       660
     SYNILNQDKI FMMEKIKILF YIIYYILYIN HFSCDKNQHD TFLRYFLFYT FQKKSTLFNI       720
     YPLLSKTQKW LPDEYKDNLL INYVVHTCCS FTKKKIQKDL KKYLIKLLIS KKHKYYQYFI       780
     KLLNEEDKNI AYFKKDIFKN THAINEYKNI HYNKNTKNEQ IYNNFINNNY KVKYNHEIIS       840
     SINKNSFVKD QRIYLYNKQI LYYQQQFYNY VFYMFRTFYE NLKLFLLPLL QNIYHNRLIY       900
     INVYMYLFMI RSYYYIQKKK KINIKNVKCE KCKIYKKCKK YQNNICYYYY YYYYYYRNNN       960
     YNNKLLINYS SEGQVLNIKD ITCTKKSKER KQSIILKYYI INLCIHLYNY YLFMLKKNKV      1020
     KKCNKMFLRK YLKLLLYIGR NILHICTHPQ HYIPFLCKMI NFVNMYIYKY VECYNDISCI      1080
     YSIKNEKMKY KNRSPSILYR FFLITKQTTN MSIHNIKKKK KKKNFCKKNK TYFIITNGNH      1140
     NIYLEKYIKK ILLNKGVQNI FHNIYVHIKE DSFSVQTKQN FIIFKLKYKE DDNTNTLQNI      1200
     YYQINGKKYF VFDNLYKLKK TYKINYIILC LLFYRYCYFF YTYNSFIFSY LFTNIFCICI      1260
     DCLNKYVIVK NCQDKKKERC QDNSHDCFYK QNGILKKNRN HILIKNFYYL IFFLLIRYHT      1320
     IIGNISHSGL QNCIPKRIMN ALKKYMNVNV ECFSSPFNSV LENYCSFFSD IDIFFGSKGD      1380
     FFKYTLKSGV YEVNPPFDIF LINKLIIYIL FKLKMDVNHL TFFLIIPYMK DINYYYELLF      1440
     SSSYLSHFFI LQRNTYTFST RLFEGRENEY ISTCDCFVFI LQNKKAQIEN RIPKKRVLKI      1500
     KKLWQNVDHI                                                             1510
//

If you have problems or comments...

PBIL Back to PBIL home page