(data stored in ACNUC9543 zone)

EMBL: AL844507.PE22

AL844507.PE22        Location/Qualifiers
FT   CDS             complement(167069..170434)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0802300"
FT                   /product="periodic tryptophan protein 2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0802300"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0130:mRNA"
FT                   /db_xref="GOA:Q8IAM3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR027145"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAM3"
FT                   /protein_id="CAD51340.1"
FT                   /translation="MLNYTLSNICGCFYTGGKILFSNDGNSLFVPVSNRINIYDLSNNS
FT                   CNTLKSESRNDIRHITIHPSMEIIITIDKFGYGCVINLLKDQIISRILFKSKTGVVTSF
FT                   NYNNMLTPQEEQDVVNSAMFTNSGKYFLITVGRRVVIWKSPCKQNNYKLIKYNDICFHS
FT                   LNVISIDISTDDKYFLTTSYDMTIRIHTVKKEKKIKPTILGGNKTTIVGAFFSKNGNFI
FT                   FSVNKSGLIIIWSYEAQTGVDEKCENFEAEKVYEDVSRDDNKGDEDVSMDDNKGDEDVS
FT                   RDDNKSDEDVSRDDENISSDNEKKKNRKEEKWSKICAHDNKIKDNTNKNKNNNHHNNNN
FT                   NNNDYFNSSVKRAFEKRWRYKRIYYCNQEKNEEVIRSCFNKEKDIFVIAFSSGRFGIYS
FT                   TPDMISLYNISINTNTIDDITINTDGEWIALGEGNNGTIIIWEWKSESYILKQNTTNKN
FT                   VKCVRFSPIISHLKIGSHIIDNSSTYHESDNFTSKFVIVTGNEDGTIKLYDYLSFINFV
FT                   TFTAHTNTVTDICFLPQGNAFISCSLDGTVRAFDLLRYRNFKIYTPDVITDLNHYSNNM
FT                   NDLNSSGKKKVDKKLNVQFLCVGVNISGNIVAAGGRGNEYVVYIWNVQTGKCIDKLFGH
FT                   NSPIIKICFSTNLKNEGVIASCSWSKNVLIWDLYARQNKGSKYEEITTSHDISYMCFDP
FT                   RGNDILAVCTLSCKIMFWDISIQEVVGTIEGARDIKRGRLLGEQFGAIPKMNKKRNRKK
FT                   SLNNVDEESMYEEDLEDQGNNTIVNQNCYFTSIDYIHNGNYIVGCANCSVSLYIYDTNL
FT                   YLLIKIIDLTKNYCVDGIKREISTRYLTSEGTHIYELDISDEEGDIYLDNYKIMNRKKK
FT                   QNLLPGQINEDYLNSKLKKYKFLLNQLHISGDDRHIAVACNTGLYVFTKDYQYQYIPSI
FT                   KNIYKGLISPNIYVPKFLTQNVNLNNLKNSLKKKEYMKAFILSLALNNYENILEVYENI
FT                   PYNIIPLCVKVLTKPFLFILINFIKTLLINDTIKHIHLHLFYLNSLFTTHFNVFLNNDF
FT                   YNHMNNNKSIKNSQDKIKTSTQNVMSNTSSLFSSDEIRTSLLLILKQIFTINNGLQYLY
FT                   SNNINVLKYLSLKE"
     MLNYTLSNIC GCFYTGGKIL FSNDGNSLFV PVSNRINIYD LSNNSCNTLK SESRNDIRHI        60
     TIHPSMEIII TIDKFGYGCV INLLKDQIIS RILFKSKTGV VTSFNYNNML TPQEEQDVVN       120
     SAMFTNSGKY FLITVGRRVV IWKSPCKQNN YKLIKYNDIC FHSLNVISID ISTDDKYFLT       180
     TSYDMTIRIH TVKKEKKIKP TILGGNKTTI VGAFFSKNGN FIFSVNKSGL IIIWSYEAQT       240
     GVDEKCENFE AEKVYEDVSR DDNKGDEDVS MDDNKGDEDV SRDDNKSDED VSRDDENISS       300
     DNEKKKNRKE EKWSKICAHD NKIKDNTNKN KNNNHHNNNN NNNDYFNSSV KRAFEKRWRY       360
     KRIYYCNQEK NEEVIRSCFN KEKDIFVIAF SSGRFGIYST PDMISLYNIS INTNTIDDIT       420
     INTDGEWIAL GEGNNGTIII WEWKSESYIL KQNTTNKNVK CVRFSPIISH LKIGSHIIDN       480
     SSTYHESDNF TSKFVIVTGN EDGTIKLYDY LSFINFVTFT AHTNTVTDIC FLPQGNAFIS       540
     CSLDGTVRAF DLLRYRNFKI YTPDVITDLN HYSNNMNDLN SSGKKKVDKK LNVQFLCVGV       600
     NISGNIVAAG GRGNEYVVYI WNVQTGKCID KLFGHNSPII KICFSTNLKN EGVIASCSWS       660
     KNVLIWDLYA RQNKGSKYEE ITTSHDISYM CFDPRGNDIL AVCTLSCKIM FWDISIQEVV       720
     GTIEGARDIK RGRLLGEQFG AIPKMNKKRN RKKSLNNVDE ESMYEEDLED QGNNTIVNQN       780
     CYFTSIDYIH NGNYIVGCAN CSVSLYIYDT NLYLLIKIID LTKNYCVDGI KREISTRYLT       840
     SEGTHIYELD ISDEEGDIYL DNYKIMNRKK KQNLLPGQIN EDYLNSKLKK YKFLLNQLHI       900
     SGDDRHIAVA CNTGLYVFTK DYQYQYIPSI KNIYKGLISP NIYVPKFLTQ NVNLNNLKNS       960
     LKKKEYMKAF ILSLALNNYE NILEVYENIP YNIIPLCVKV LTKPFLFILI NFIKTLLIND      1020
     TIKHIHLHLF YLNSLFTTHF NVFLNNDFYN HMNNNKSIKN SQDKIKTSTQ NVMSNTSSLF      1080
     SSDEIRTSLL LILKQIFTIN NGLQYLYSNN INVLKYLSLK E                          1121
//

If you have problems or comments...

PBIL Back to PBIL home page