(data stored in ACNUC9543 zone)

EMBL: AL844507.PE223

AL844507.PE223       Location/Qualifiers
FT   CDS             complement(1000981..1003755)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0822700"
FT                   /product="thrombospondin-related protein 1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0822700"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.45:mRNA"
FT                   /db_xref="GOA:C0H4X0"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR036383"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4X0"
FT                   /protein_id="CAX64148.1"
FT                   /translation="MYNHFLYFPFEKFLFIFILVVWLAFQTNKRPSYITKKYKIDDVKN
FT                   IDMIIQHDIVINTQNIMCIFYILYINNLDKNKNFIQYKNFKKNKSYKYKNNNNNIIIIN
FT                   SHSHSNSHSNSHSHSNSHSNSHSHSNSHSNSHSHSNSHSHSHSNSHSNSHSHSSTQNSL
FT                   YHDTNQANFLKPTSFFLYKHHVYFNQKYKKDPNILNKLKVPRNHIFHINKCDLNYYIQN
FT                   YEFFFFFPDYYEYSHLYIRLDKLFYFQRCGCDTNIKKTKKRNQNIFNNMLGMKEKDTYL
FT                   QNEICDIYWNYLKDDNTYDKYNFSIINYIKNIIKKMYRYLYIYKVFVLKQFYRIVYYNQ
FT                   GIRNFYYMLFSYIYNKGSIIYNYNQMYFKKHRKKQTIIRSKRFMNEHIKEEDVDYNIVK
FT                   DEKDKSIQSTEQKSYLKNNTIQYFQCFLDKAMENKNAENELDKWIDPQSKSCYCSEEFA
FT                   EPCTSEDLVDINNINQIMDNAFCEYNNNDNNNNDNNKNNNNNINNIINIYDNNILGDNV
FT                   KNIFVALSEYKILQCNDKEKKDIIKKEQLYNYCKYGLNIWDNKNMYDYLNCLNVISYNK
FT                   KDDKTCIRKCENIKKLCNIVAQFYSFEVCKKYYENNKHTEDIYINNFKYFSDHCKYIDP
FT                   TNRGLVLCKHKNVECVYSQWSEWSTCSKTCIENEYDTNSTRTRTRILLNKFEVPSKSCS
FT                   FIINEKNNLMDINFCSYLPFCNKNNDMKKKDDERIMPFVISIKEIEKLNTLKYLNNDDN
FT                   DLLNENYKNYESVHKNNECKVTDMYQYEYAISYNEKNKSCSCPNNQSPCYFKDIYNSES
FT                   WKKSLHILCKHNPHINVITADYIIIDCNMSISIKKKEIAVNTYLAMTFNCHSDIFQYIF
FT                   CAKNIQSIRTNFIYIIITCAFGFISAIYIIHIFINKWHIFKLLLHKQNKKKSY"
     MYNHFLYFPF EKFLFIFILV VWLAFQTNKR PSYITKKYKI DDVKNIDMII QHDIVINTQN        60
     IMCIFYILYI NNLDKNKNFI QYKNFKKNKS YKYKNNNNNI IIINSHSHSN SHSNSHSHSN       120
     SHSNSHSHSN SHSNSHSHSN SHSHSHSNSH SNSHSHSSTQ NSLYHDTNQA NFLKPTSFFL       180
     YKHHVYFNQK YKKDPNILNK LKVPRNHIFH INKCDLNYYI QNYEFFFFFP DYYEYSHLYI       240
     RLDKLFYFQR CGCDTNIKKT KKRNQNIFNN MLGMKEKDTY LQNEICDIYW NYLKDDNTYD       300
     KYNFSIINYI KNIIKKMYRY LYIYKVFVLK QFYRIVYYNQ GIRNFYYMLF SYIYNKGSII       360
     YNYNQMYFKK HRKKQTIIRS KRFMNEHIKE EDVDYNIVKD EKDKSIQSTE QKSYLKNNTI       420
     QYFQCFLDKA MENKNAENEL DKWIDPQSKS CYCSEEFAEP CTSEDLVDIN NINQIMDNAF       480
     CEYNNNDNNN NDNNKNNNNN INNIINIYDN NILGDNVKNI FVALSEYKIL QCNDKEKKDI       540
     IKKEQLYNYC KYGLNIWDNK NMYDYLNCLN VISYNKKDDK TCIRKCENIK KLCNIVAQFY       600
     SFEVCKKYYE NNKHTEDIYI NNFKYFSDHC KYIDPTNRGL VLCKHKNVEC VYSQWSEWST       660
     CSKTCIENEY DTNSTRTRTR ILLNKFEVPS KSCSFIINEK NNLMDINFCS YLPFCNKNND       720
     MKKKDDERIM PFVISIKEIE KLNTLKYLNN DDNDLLNENY KNYESVHKNN ECKVTDMYQY       780
     EYAISYNEKN KSCSCPNNQS PCYFKDIYNS ESWKKSLHIL CKHNPHINVI TADYIIIDCN       840
     MSISIKKKEI AVNTYLAMTF NCHSDIFQYI FCAKNIQSIR TNFIYIIITC AFGFISAIYI       900
     IHIFINKWHI FKLLLHKQNK KKSY                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page