(data stored in ACNUC9543 zone)

EMBL: AL844507.PE224

AL844507.PE224       Location/Qualifiers
FT   CDS             1005836..1006810
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0822800"
FT                   /product="U5 small nuclear ribonucleoprotein 40 kDa
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0822800"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.43:mRNA"
FT                   /db_xref="GOA:C0H4X1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4X1"
FT                   /protein_id="CAX64149.1"
FT                   /translation="MALIKADTYVLERDENNEVEERKTGLFSPTMLINSHKGEVYSINF
FT                   SSDGKYIASSSFDMTIMVHNVYNECETIGVLRGHKNAVLQAKWLQDDNYICSASADHKL
FT                   FLWDVECESKLRSFKGHDNIVNGLDIINHNLFVSCSDDNTLKFWDIRSKWAVHIIKHDF
FT                   PLLSVCSDKKGEFLFTSCVDNTIKKYDCKNYKLKDTFIGHKDYITGLDINKDETMLASI
FT                   SADESICFWDIQPFSCEEKLLFQLNSPKYNIDYNLIKLSFNNDNLLACGSGDNYLYIYD
FT                   YKQKILKYSLPGHTSTINDVAFHPVEDIVASCSSDHTIFLGEI"
     MALIKADTYV LERDENNEVE ERKTGLFSPT MLINSHKGEV YSINFSSDGK YIASSSFDMT        60
     IMVHNVYNEC ETIGVLRGHK NAVLQAKWLQ DDNYICSASA DHKLFLWDVE CESKLRSFKG       120
     HDNIVNGLDI INHNLFVSCS DDNTLKFWDI RSKWAVHIIK HDFPLLSVCS DKKGEFLFTS       180
     CVDNTIKKYD CKNYKLKDTF IGHKDYITGL DINKDETMLA SISADESICF WDIQPFSCEE       240
     KLLFQLNSPK YNIDYNLIKL SFNNDNLLAC GSGDNYLYIY DYKQKILKYS LPGHTSTIND       300
     VAFHPVEDIV ASCSSDHTIF LGEI                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page