(data stored in ACNUC9543 zone)

EMBL: AL844507.PE228

AL844507.PE228       Location/Qualifiers
FT   CDS             complement(join(1022629..1022985,1023096..1023539,
FT                   1023787..1023846))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0823200"
FT                   /product="RNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0823200"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.40:mRNA"
FT                   /db_xref="GOA:Q8IB66"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB66"
FT                   /protein_id="CAD51141.1"
FT                   /translation="MSLTNSSKIFIGSIPKDVTEEELKTEAAKYGTITQVYYVPATAQS
FT                   PRGWAFITYEQRSEAYKAIEALDYKCIFPNSQRPLDVRFASYKYNNSNDAQGGNKNVWQ
FT                   KHVTTDGHPYYYNSVTGHSQWEKPKEMSATNFPGKGSAPSFGPPGANVFVFHLPSHWTD
FT                   MELYQHFQHFGYVVSARIQRDANGRNKGYGFVSFNNPESALNAIKGMHGFYVSGKHLKV
FT                   QLKKGEEHYVQMNTPAQPQLTPAQPYSVQQPIIGNHHQPYMTHLMYGGMDSPNQMRYNT
FT                   YSISR"
     MSLTNSSKIF IGSIPKDVTE EELKTEAAKY GTITQVYYVP ATAQSPRGWA FITYEQRSEA        60
     YKAIEALDYK CIFPNSQRPL DVRFASYKYN NSNDAQGGNK NVWQKHVTTD GHPYYYNSVT       120
     GHSQWEKPKE MSATNFPGKG SAPSFGPPGA NVFVFHLPSH WTDMELYQHF QHFGYVVSAR       180
     IQRDANGRNK GYGFVSFNNP ESALNAIKGM HGFYVSGKHL KVQLKKGEEH YVQMNTPAQP       240
     QLTPAQPYSV QQPIIGNHHQ PYMTHLMYGG MDSPNQMRYN TYSISR                      286
//

If you have problems or comments...

PBIL Back to PBIL home page