(data stored in ACNUC9543 zone)

EMBL: AL844507.PE23

AL844507.PE23        Location/Qualifiers
FT   CDS             join(171865..173899,174154..174211,174334..174385)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0802400"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0802400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.152:mRNA"
FT                   /db_xref="GOA:Q8IAM4"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAM4"
FT                   /protein_id="CAD51339.1"
FT                   /translation="MKIFQTNVDNFNLNICEQNENIILKKKEIQENINETCGHVEYIKN
FT                   DIQQNEDPCYNDNNTCFDDDIFLRSRKSVPSAFTHKISDDDMDKKRVPEQNDVDNKNDI
FT                   KRDNNNNYSNDNNYSNNNNNNNNNNNIVNDDISMSPKKKKAKYNNTGKDKNEDDNSNNC
FT                   NNCNNCNDGNDSCDDNSHHNPNNVNRLREEIKKELFNKLNIILDVNMNMNTDEEYYMKF
FT                   LKKKKFRNYIMNTSKFIIILGKYLQLSFCTICIALYYMNKYNQKILKRKKNSISYLIAG
FT                   ACIFLAWKLREDFELLKKSRKLYDIPKVIFKLLNYFYKKKKLKKKIHSIELDIITNYKI
FT                   NHTFYNTQLFNHKTFSSFMEHMKKEDTYIDTKKESKNRKQSNGSQINNNLNNVQKNKSI
FT                   YNDLQELNNIIQEGYISDINNINHVSDCFSSYLSECNSSDVSEYDQMKPEQDEPINIQT
FT                   DVKDENGKMGSQHCDVKRENIKIKHEMNGDLHEQNGKLHEQNGDLHEQNGKLHEQNGKL
FT                   HEQNGDLHDQSGDLHEQNSLTENIKKFKKLCKEHKKNIYVSSSKWVLNNSGQKLQLMQK
FT                   IIIYYEGEILKSFNYYIKPKMLFFELLPSYINKFVYTMKGYIELDQVVYLEKLCLLTIL
FT                   DIYKTPLCLIFTPKEILITCILKAYISLKLLSNQLHIRSLSFQDFEDKINSFIQSVCCE
FT                   DPINVYRIKTALRELRQLHF"
     MKIFQTNVDN FNLNICEQNE NIILKKKEIQ ENINETCGHV EYIKNDIQQN EDPCYNDNNT        60
     CFDDDIFLRS RKSVPSAFTH KISDDDMDKK RVPEQNDVDN KNDIKRDNNN NYSNDNNYSN       120
     NNNNNNNNNN IVNDDISMSP KKKKAKYNNT GKDKNEDDNS NNCNNCNNCN DGNDSCDDNS       180
     HHNPNNVNRL REEIKKELFN KLNIILDVNM NMNTDEEYYM KFLKKKKFRN YIMNTSKFII       240
     ILGKYLQLSF CTICIALYYM NKYNQKILKR KKNSISYLIA GACIFLAWKL REDFELLKKS       300
     RKLYDIPKVI FKLLNYFYKK KKLKKKIHSI ELDIITNYKI NHTFYNTQLF NHKTFSSFME       360
     HMKKEDTYID TKKESKNRKQ SNGSQINNNL NNVQKNKSIY NDLQELNNII QEGYISDINN       420
     INHVSDCFSS YLSECNSSDV SEYDQMKPEQ DEPINIQTDV KDENGKMGSQ HCDVKRENIK       480
     IKHEMNGDLH EQNGKLHEQN GDLHEQNGKL HEQNGKLHEQ NGDLHDQSGD LHEQNSLTEN       540
     IKKFKKLCKE HKKNIYVSSS KWVLNNSGQK LQLMQKIIIY YEGEILKSFN YYIKPKMLFF       600
     ELLPSYINKF VYTMKGYIEL DQVVYLEKLC LLTILDIYKT PLCLIFTPKE ILITCILKAY       660
     ISLKLLSNQL HIRSLSFQDF EDKINSFIQS VCCEDPINVY RIKTALRELR QLHF             714
//

If you have problems or comments...

PBIL Back to PBIL home page