(data stored in ACNUC9543 zone)

EMBL: AL844507.PE231

AL844507.PE231       Location/Qualifiers
FT   CDS             complement(1037100..1038608)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0823500"
FT                   /product="inner membrane complex protein 1i, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0823500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0033:mRNA"
FT                   /db_xref="GOA:Q8IB69"
FT                   /db_xref="InterPro:IPR022086"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB69"
FT                   /protein_id="CAD51138.1"
FT                   /translation="MQGETINVPSSSVPYTFEHSKHLKSKILKPIRQEKVVKVPVTQYV
FT                   EKIVEKEEIKYVNKYVDVIKPIITYKTKHISKPIYLDKIKYQPKVVEKEKIIHIPKIEY
FT                   RNKIVEIPVYVHKENIIEKKVPLIVERVVPVLKVNRVEKEILTNSFEIPEICEMTKDEN
FT                   NIHIGKNVHETNQQISCNVSEKGNSFVSEINKEKSDIYNIETYRHMQTTNASPKVYSQL
FT                   EISSSNMDNQNVETLKDKNNVVDSNDTSDEEEYNEGNLEHKNETRYHEATNEYSNYDFT
FT                   SEKNQKINDEENNSKELINNNNMEENYYDIDERFKDSNISHVSIHLPEEKGIEQQSYEQ
FT                   NYMNSCNNNYNIIESNLGDTSGSVYNNINTYGTYYSDNMNPQFDKTFVNQSYNGSKGYI
FT                   QKIMQRNHIPNYSTNTMEHLKIVEEKHPNSSNLHISNERFSTLPSVYGARSVTGKSNFV
FT                   PSYANSNGQAIVSVRPATIVEYVPKSKKYKASLCNFINKCCGNM"
     MQGETINVPS SSVPYTFEHS KHLKSKILKP IRQEKVVKVP VTQYVEKIVE KEEIKYVNKY        60
     VDVIKPIITY KTKHISKPIY LDKIKYQPKV VEKEKIIHIP KIEYRNKIVE IPVYVHKENI       120
     IEKKVPLIVE RVVPVLKVNR VEKEILTNSF EIPEICEMTK DENNIHIGKN VHETNQQISC       180
     NVSEKGNSFV SEINKEKSDI YNIETYRHMQ TTNASPKVYS QLEISSSNMD NQNVETLKDK       240
     NNVVDSNDTS DEEEYNEGNL EHKNETRYHE ATNEYSNYDF TSEKNQKIND EENNSKELIN       300
     NNNMEENYYD IDERFKDSNI SHVSIHLPEE KGIEQQSYEQ NYMNSCNNNY NIIESNLGDT       360
     SGSVYNNINT YGTYYSDNMN PQFDKTFVNQ SYNGSKGYIQ KIMQRNHIPN YSTNTMEHLK       420
     IVEEKHPNSS NLHISNERFS TLPSVYGARS VTGKSNFVPS YANSNGQAIV SVRPATIVEY       480
     VPKSKKYKAS LCNFINKCCG NM                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page