(data stored in ACNUC9543 zone)

EMBL: AL844507.PE232

AL844507.PE232       Location/Qualifiers
FT   CDS             complement(1039907..1041211)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0823600"
FT                   /product="lipoate-protein ligase B"
FT                   /EC_number="6.3.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0823600"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.37:mRNA"
FT                   /db_xref="GOA:Q8IB70"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB70"
FT                   /protein_id="CAD51137.2"
FT                   /translation="MNKINLLVLISLTFIILLNPKMKVGKLKKRKNSGLLYPYFKNKSF
FT                   RLNRYIFIKPIKSVKLNYKKKKMNLTHEICILNCSEKLIDYKLAFQLQNILHHSKIIMK
FT                   NKNEVQISNHLELKKFKNFKENMEKYDFCFILQHTPCYTLGSVANCSDILLDKENYYIE
FT                   ELGDIYNNLYSNEIIHLMNKCETIQDKINQSDIYNENTNYFNNFLKHCRQRKIPIYRVN
FT                   RGGKATYHGPGQLVLYFIFNLKNYPSNYNERIINKHYKYTNKENFPSKTSEYEKNNIYT
FT                   NSNSKENISSIERTFDLRTTINNFQKIGMETLQKFNIKTHCKKDTIGIFYKDKKIISIG
FT                   LKITKYISMHGLSLNFNLDNNFLKYLLSCGMNHNDYISMHEINEMKKKNYIYQKGKIAS
FT                   SSNILNELTLNITESLKKVFNVKVRNIKDIREMFY"
     MNKINLLVLI SLTFIILLNP KMKVGKLKKR KNSGLLYPYF KNKSFRLNRY IFIKPIKSVK        60
     LNYKKKKMNL THEICILNCS EKLIDYKLAF QLQNILHHSK IIMKNKNEVQ ISNHLELKKF       120
     KNFKENMEKY DFCFILQHTP CYTLGSVANC SDILLDKENY YIEELGDIYN NLYSNEIIHL       180
     MNKCETIQDK INQSDIYNEN TNYFNNFLKH CRQRKIPIYR VNRGGKATYH GPGQLVLYFI       240
     FNLKNYPSNY NERIINKHYK YTNKENFPSK TSEYEKNNIY TNSNSKENIS SIERTFDLRT       300
     TINNFQKIGM ETLQKFNIKT HCKKDTIGIF YKDKKIISIG LKITKYISMH GLSLNFNLDN       360
     NFLKYLLSCG MNHNDYISMH EINEMKKKNY IYQKGKIASS SNILNELTLN ITESLKKVFN       420
     VKVRNIKDIR EMFY                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page