(data stored in SCRATCH zone)

EMBL: AL844507.PE233

AL844507.PE233       Location/Qualifiers
FT   CDS             complement(join(1041832..1041984,1042280..1042327))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0823700"
FT                   /product="mitochondrial import receptor subunit TOM7,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0823700"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.36:mRNA"
FT                   /db_xref="GOA:Q8IB71"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB71"
FT                   /protein_id="CAD51136.1"
FT                   /translation="MKEYHISIDTKKIFDRAYAISLKMCDKFIRPFLYYGFTPMIFGYG
FT                   LYYNNEFTLNPFKLIPKILIG"
     MKEYHISIDT KKIFDRAYAI SLKMCDKFIR PFLYYGFTPM IFGYGLYYNN EFTLNPFKLI        60
     PKILIG                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page