(data stored in ACNUC9543 zone)

EMBL: AL844507.PE234

AL844507.PE234       Location/Qualifiers
FT   CDS             1043813..1045780
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0823800"
FT                   /product="DnaJ protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0823800"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0032:mRNA"
FT                   /db_xref="GOA:Q8IB72"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB72"
FT                   /protein_id="CAD51135.1"
FT                   /translation="MGRKASNDSYENSDVNGAVSKRKSKGKDDINDIMNDLNKKKMNEK
FT                   KNMKDKKDGNFSGNMIGGMYKNKLRYILDNIIIISIILSFVVLISFKYLEEKYSIESYF
FT                   EDGDSFDYYEVLKCKRGDSIQKIKKNYRDLSKQYHPDSNKNCKDCDKKFQEITKAYKTL
FT                   SDSRLKKAYDNSKGKVLKLIESNSINLNMKNYVDLVENSNDYWIIQIYSDTDSLCLSFS
FT                   NIWEESFDKYHEYISFGRINISTDKKLIKQKVPFNVKIYPTIFILSPDGTYQLYSNIFN
FT                   ATSKDFQNFITSNYPNNIYDLKMLNDALYKMSSLNVKKSGYIDKNHHVILLTNKKKLSL
FT                   QAKQITYKFNNIYKTYSIKYNEIDNISNESIKKSIIDSLKVLSIKKDEYLKENQNIDYF
FT                   ILVNNNQVKIIRRISPTNIKNVYNDALKKNIVEINSINVDSVCSTMGSRKTYCYVIFVD
FT                   NVDDEKNVNYMRKTYQNINSSYNKFVSKNGSEETEEQLFIQPVYVLKKNLTKKFNKFIN
FT                   DKTINKYDSFLLDYSSNTFSSINEIKNLSNYSQNKDDLSFLHNIYKDIEILNFQKIPKY
FT                   CLPFNINCLFNIKTTTPYKLYNIINRTSKLQIIFSLIVGFMLFPTFKEYGFLKYVLFAL
FT                   SVGFSVIVINIKDFILLLAS"
     MGRKASNDSY ENSDVNGAVS KRKSKGKDDI NDIMNDLNKK KMNEKKNMKD KKDGNFSGNM        60
     IGGMYKNKLR YILDNIIIIS IILSFVVLIS FKYLEEKYSI ESYFEDGDSF DYYEVLKCKR       120
     GDSIQKIKKN YRDLSKQYHP DSNKNCKDCD KKFQEITKAY KTLSDSRLKK AYDNSKGKVL       180
     KLIESNSINL NMKNYVDLVE NSNDYWIIQI YSDTDSLCLS FSNIWEESFD KYHEYISFGR       240
     INISTDKKLI KQKVPFNVKI YPTIFILSPD GTYQLYSNIF NATSKDFQNF ITSNYPNNIY       300
     DLKMLNDALY KMSSLNVKKS GYIDKNHHVI LLTNKKKLSL QAKQITYKFN NIYKTYSIKY       360
     NEIDNISNES IKKSIIDSLK VLSIKKDEYL KENQNIDYFI LVNNNQVKII RRISPTNIKN       420
     VYNDALKKNI VEINSINVDS VCSTMGSRKT YCYVIFVDNV DDEKNVNYMR KTYQNINSSY       480
     NKFVSKNGSE ETEEQLFIQP VYVLKKNLTK KFNKFINDKT INKYDSFLLD YSSNTFSSIN       540
     EIKNLSNYSQ NKDDLSFLHN IYKDIEILNF QKIPKYCLPF NINCLFNIKT TTPYKLYNII       600
     NRTSKLQIIF SLIVGFMLFP TFKEYGFLKY VLFALSVGFS VIVINIKDFI LLLAS            655
//

If you have problems or comments...

PBIL Back to PBIL home page